Words Containing: Y,S
(In Any Order)
There are 21,073 words,
7,959 phrases and
2 abbr's with
Y,S in.
Best Scoring Words With: Y,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| schizzy | 7 | 33 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| scuzzy | 6 | 29 | adjectiveadj | |||||
adjective • Dirty or grimy. • Disreputable; sleazy. | ||||||||
| snazzy | 6 | 27 | adjectiveadj | |||||
adjective satellite • flashily stylish | ||||||||
| skyjack | 7 | 27 | verbv | |||||
verb • subject an aircraft to air piracy | ||||||||
| syzygy | 6 | 25 | nounn | |||||
noun • the straight line configuration of 3 celestial bodies (as the sun and earth and moon) in a gravitational system | ||||||||
| squiffy | 7 | 25 | adjectiveadj | |||||
adjective satellite • very drunk | ||||||||
| asphyxy | 7 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| zephyrs | 7 | 24 | nounn | |||||
noun • (Greek mythology) the Greek god of the west wind • a slight wind (usually refreshing) | ||||||||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| jockeys | 7 | 23 | nounn | |||||
noun • someone employed to ride horses in horse races • an operator of some vehicle or machine or apparatus verb • defeat someone through trickery or deceit • compete (for an advantage or a position) • ride a racehorse as a professional jockey | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1146)
alwaysmyselfsayingsystemsimplyslowlysundaysurelyeasilysafetymostlysupplysalarysteadysymbolskinnyjerseysafelysoftlymiserysylviasydneysubwaysleepywhiskyspyingasylumshortyshellyclassyclumsydisneystickysidneywesley
...View all with 6 letters...
Phrases (13)
stay onslip bypass bystay atstay upso yeahsex toycy presu. s. armybig yus
...View all with 6 letters...
Words (1668)
historystayingusuallydestroysocietymajestydestinymysterysurgerysomedaytuesdayfantasythirstycustodycrystalstanleyanywayswhiskeycloselyshortlytestifyphysicsembassypsychicdisplayautopsyhonestysatisfyseventyecstasyjustifynurserylindsayslaverydynasty
...View all with 7 letters...
Phrases (59)
stay putsea lilybusy beezea maysstir fryin styleeye maskj. m. syngepsych up365 days
...View all with 7 letters...
Words (2290)
yourselfsomebodysecuritysuddenlysaturdaypossiblyhonestlystudyingphysicalthursdayindustrynowadaysslightlystrategyministryanalysissecretlystrictlysympathyyoungestassemblysexuallyjealousystronglysyndromecourtesyinsanitysolitaryolympicsslipperyrosemaryreynoldssecondlyseverelysmoothly
...View all with 8 letters...
Phrases (126)
boy scoutby rightsbody suitsonny boysmall fryshut awaytype slugsea nymphswamp bayold style
...View all with 8 letters...
Words (2745)
yesterdayseriouslyobviouslynecessarydestroyedbasicallysecretarywednesdaypreciselydiscoverytestimonyanonymouschemistrycuriosityspeciallylifestyleinstantlyspecialtysincerelystrangelysecondarypsychoticmysteriesstupiditymonasteryphysiciansexualityyggdrasilsanctuarynecessityintensitysinceritydestroyerraspberryseemingly
...View all with 9 letters...
Phrases (232)
salary cutlake nyasahigh stylebody wasteshy personready cashyard grassdry socketdyer's weedgunny sack
...View all with 9 letters...
Words (2881)
absolutelyespeciallyuniversitypersonallymysteriousconstantlyphilosophyphysicallyconspiracypreviouslypsychologystrawberrysupposedlyscreenplayhystericalbabysitterpsychopathprosperityseparatelygenerositysolidaritypositivelymissionarydisneylandapocalypsemayonnaiseeyewitnesshypothesisdisabilitypresidencysatisfyingpresumablygymnasticsenormouslysimplicity
...View all with 10 letters...
Phrases (331)
yves tanguyshort storygenus lygusfleur-de-lysepoxy resinbrya ebenusbrandy nosecygnus olorroot systemmoshe dayan
...View all with 10 letters...
Words (2635)
possibilityanniversarypersonalitynecessarilyessentiallycountrysidedesperatelyunnecessarypsychiatrichospitalitysympatheticsensitivitytrustworthyexclusivelybabysittingcontroversyyellowstoneobservatorysovereigntydangerouslysuperiorityrespiratoryspirituallyconsciouslyconsistencysymmetricalmercilesslystorytelleranonymouslydrasticallyinstabilitymonstrosityexcessivelyaristocracypsychedelic
...View all with 11 letters...
Phrases (467)
genus lycosagenus myxinegrass familylaying wastelouis leakeysilver berrymighty mousebody processbody servantgenus styrax
...View all with 11 letters...
Words (2315)
psychiatristspecificallyoccasionallypsychologistchristianitysuccessfullyincreasinglysurprisinglyindistinctlypennsylvaniacontinuouslydisciplinaryrespectfullypassionatelysufficientlyconservatorysatisfactorymysteriouslyspiritualitystraightawayconsiderablygynecologistmiraculouslyconsistentlysynchronizedtremendouslyconsequentlyhistoricallyaggressivelysubsequentlyinvisibilitybloodthirstyridiculouslymetaphysicalstorytelling
...View all with 12 letters...
Phrases (543)
backspace keymrs. henry woodstaying powerbody stockinggenus glycinevisual acuityscantily cladlickety splitcalvary crossearnest money
...View all with 12 letters...
Words (1776)
psychologicalunnecessarilyhomosexualitysignificantlyinstinctivelystatisticallyspontaneouslytyrannosaurusdysfunctionalunconsciouslyinterestinglyimpossibilitypsychoanalystfantasticallyprogressivelyhieroglyphicsphysiologicalpsychosomaticsubstantiallychrysanthemumgynaecologistpsychotherapyrealisticallystrategicallyuntrustworthyphysiotherapyspectacularlysarcasticallyastonishinglysupplementaryeverlastinglyhyperhidrosisstereotypicalconsecutivelypainstakingly
...View all with 13 letters...
Phrases (613)
harvey cushingaleatory musicel iskandriyahauditory sensesecond balconyin a similar waynursery schooladvisory boardcustody battlesystem command
...View all with 13 letters...
Words (1255)
responsibilitysimultaneouslyprofessionallyscientificallypsychoanalysissystematicallyunderstandablysubconsciouslysentimentalityrespectabilityhypersensitivesustainabilityunquestionablycytogeneticistundersecretaryphotosynthesisastrophysicistunsatisfactoryunsuccessfullythermodynamicsconservativelyparapsychologypsychoanalyticdiscriminatorychemosynthesiscontemptuouslypsychoneuroticsubcutaneouslysupernaturallysusceptibilitysatisfactorilyembarrassinglylinguisticallygeosynchronousmetaphysically
...View all with 14 letters...
Phrases (646)
anthony burgessfield intensitybattle of nasebymoonseed familyorder mysidaceamyrrhis odoratatrionyx muticusyellowish brownsabbatical yearclass scyphozoa
...View all with 14 letters...
Words (827)
psychologicallypsychotherapistinstantaneouslysynchronizationanaesthesiologyphysiologicallydisrespectfullyphilosophicallyphysiotherapistheterosexualityconscientiouslysympathomimeticsynergisticallyinaccessibilitycrystallizationoversimplifyingsurreptitiouslypsychobiologistcondescendinglysuppositionallymicroscopicallysynchronisationdisappointinglyinfinitesimallyinstrumentalitycontroversiallyinconspicuouslysuccinylcholineneurophysiologycytomegaloviruscompassionatelystereochemistryrecrystallizinglackadaisicallyphotosynthesize
...View all with 15 letters...
Phrases (709)
syringa vulgarisauditory ossicleby fits and startsstay of executioncentaurea cyanusclass pelecypodaalimentary pasteasamiya languagehelen wills moodydialysis machine
...View all with 15 letters...
Words (332)
enthusiasticallyindiscriminatelyirresponsibilityconstitutionallyincomprehensiblycatastrophicallypsychoanalyticalquintessentiallyuncompromisinglypsychophysiologyjournalisticallycircumstantiallysphygmomanometermonosyllabicallyerythroblastosisextemporaneouslythermostaticallysurrealisticallypsychobiologicalelectrochemistryrhabdomyosarcomahypersensitivityunprofessionallyparapsychologistconversationallyneuropsychiatricpolydispersitiesdiscriminatorilyhypersalivationsinextinguishablypolyelectrolytesjurisdictionallyantistrophicallyspondylarthritiscommensurability
...View all with 16 letters...
Phrases (653)
in a beastly mannerstrictly speakingchristian huygenscardiac glycosidecygnus buccinatorgenus crotaphytusbluegrass countrychemical analysisamerican sycamorehypophyseal stalk
...View all with 16 letters...
Words (177)
straightforwardlycounterinsurgencysuperconductivityconstitutionalitymaterialisticallycardiorespiratoryneurophysiologistelectrostaticallycontemporaneouslyinconsequentiallysocioeconomicallypsycholinguisticspsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeuticparaformaldehydeskaleidoscopicallyspondylolisthesisradioimmunoassaysradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectrophotometryspectroscopicallyhyperventilationsnonprofessionallyrationalisticallysphygmomanometershypnotizabilities
...View all with 17 letters...
Phrases (650)
gopherus polypemusdivision bryophytasalvia leucophyllabalaena mysticetusinterstate highwaypearly everlastingclass rhodophyceaefamily dasypodidaelycopus americanussubphylum craniata
...View all with 17 letters...
Words (120)
characteristicallydisproportionatelyinconsequentialitypsychopharmacologypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalhypersensitivenesspolyesterificationspectrofluorometrymethyltestosteronecoccidioidomycosishypersensitivitieshypersensitizationpolymorphonuclearsspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometrieshypoparathyroidismhypophysectomizingpathophysiologicalhyposensitizationspentylenetetrazolscylindrical-stemmedlaryngopharyngitisperchloroethyleneslipopolysaccharidepostpsychoanalytictriphosphopyridineunconstitutionallylymphangiographiesstereospecificallytransformationally
...View all with 18 letters...
Phrases (610)
worldly possessionsbombycilla garrulusadministrative bodydivision anthophytafamily physeteridaedame sybil thorndikelachrymal secretiondivision cynodontiafreudian psychologygenus styracosaurus
...View all with 18 letters...
Words (64)
hyperparathyroidismpsychophysiologicalpolyesterificationshypersensitizationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomieshypoparathyroidismscrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallycytopathogenicitiesimmunocytochemistrydiethylstilbesterolindividualisticallydiethylstilboestrolphenomenalisticallyphosphatidylcholineelectrodynamometersphosphoenolpyruvatechromoblastomycosiscontradistinctivelythird-dimensionalityhysterosalpingogramcross-linguisticallythree-dimensionalityimpressionisticallymethylcholanthrenesmethylprednisoloneselectrophysiologieselectrophysiologist
...View all with 19 letters...
Phrases (509)
building supply houseacetylsalicylic acidscandinavian countryjohn millington syngefamily cynoglossidaeseventeen-year locusthydrastis canadensisclass polyplacophoragiles lytton stracheyfamily lepisosteidae
...View all with 19 letters...
Words (48)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhypersensitivenessesradioimmunoassayablelipochondrodystrophycrystallographicallyhyperadrenocorticismindistinguishabilitycytodifferentiationslymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditisphotophosphorylationpseudoparenchymatoushydrochlorothiazides
...View all with 20 letters...
Phrases (407)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesbalaenoptera physalusoryctolagus cuniculusdivision tracheophytabalance sheet analysis
...View all with 20 letters...
Words (17)
psychopharmacologicalotorhinolaryngologisthypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesmucopolysaccharidosisalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologiesphotophosphorylationsintersubstitutabilityhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (300)
electrolytic condensernikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumdesoxyribonucleic acidsri lankan monetary unitpseudemys rubriventriseucalyptus fraxinoides
...View all with 21 letters...
Words (8)
spectrophotometricallyintercomprehensibilityphosphoglyceraldehydesotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (256)
lycopersicon esculentumhaliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factloyalist volunteer forcesubfamily bassariscidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (195)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusparis-sorbonne universitykyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (144)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytasubphylum cephalochordatamary wollstonecraft godwinzollinger-ellison syndromeprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (109)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraeigor fyodorovich stravinskymary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatusmodest petrovich mussorgskyedmund john millington syngepolystichum acrostichoides
...View all with 25 letters...
Phrases (77)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision basidiomycotina
...View all with 26 letters...
Phrases (65)
business environment analysisnikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugincommissioned military officernuclear regulatory commissionpull the wool over someone's eyesdeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drug
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (51)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Phrases (29)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensis
...View all with 29 letters...
Phrases (30)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndrome
...View all with 30 letters...
Phrases (16)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (24)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (14)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (10)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (10)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (15)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciences
...View all with 37 letters...
