Dictionary Only:
Profanity Off:

10-Letter Words Containing: Y,S

 (In Any Order)
There are 2,881 10 letter words, 331 10 letter phrases and 0 10 letter abbr's with Y,S in.

Best Scoring 10 Letter Words With: Y,S

Expand?WordSave?LengthUsagePointsType
exoenzymes10
31 nounn
noun

• Any enzyme, generated by a cell, that functions outside of that cell.

skyjacking10
31 verb, nounv, n
verb

• subject an aircraft to air piracy

oxygenizes10
30
verb

• change (a compound) by increasing the proportion of the electronegative part; or change (an element or ion) from a lower to a higher positive valence: remove one or more electrons from (an atom, ion, or molecule)

• dehydrogenate with oxygen

• impregnate, combine, or supply with oxygen

rhythmizes10
30 verbv
Valid word for Scrabble US
skyjackers10
30 nounn
Valid word for Scrabble US
jayhawkers10
30 nounn
Valid word for Scrabble US
sympathize10
29 verbv
verb

• share the feelings of; understand the sentiments of

• be understanding of

• to feel or express sympathy or compassion

hydrolyzes10
29 verbv
verb

• undergo hydrolysis; decompose by reacting with water

mythicizes10
29 verbv
verb

• interpret as a myth or in terms of mythology

• make into a myth

mycorhizas10
29 nounn
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (2881)
absolutelyespeciallyuniversitypersonallymysteriousconstantlyphilosophyphysicallyconspiracypreviouslypsychologystrawberrysupposedlyscreenplayhystericalbabysitterpsychopathprosperityseparatelygenerositysolidaritypositivelymissionarydisneylandapocalypsemayonnaiseeyewitnesshypothesisdisabilitypresidencysatisfyingpresumablygymnasticsenormouslysimplicityyugoslaviahopelesslyreasonablycompulsoryhyperspacespecialityinsecuritysympathizevisibilitypsychiatrytestifyingdiscreetlysimilaritydistinctlysystematichydraulicsgenerouslysensualitystereotypeschoolyardsleepyheadphysiologydisorderlyvigorouslypleasantlystationerymistakenlygraciouslyexpresswayskyscraperstationaryneedlesslyunderstudycyberspacehandsomelystealthilysurgicallyupholsterycarelesslypassagewaystuyvesanthelplesslydishonestypythagorassubsidiaryrecklesslydostoevskysynonymouseucalyptusshockinglytirelesslyhieronymusstravinskycautiouslygettysburgskillfullycosmicallycommissarysymbolizedinsurgencyjustifyingruthlesslyfabulouslystrychninegooseberrymisogynistdisloyaltysyndicatedeyeglassesdisqualifyunsanitarysplendidlynarcolepsyscathinglystoryboarddispensarypromissorynewsworthypainlesslyostensiblysignifyingsympathisestunninglyimpossiblygrievouslygloriouslyfearlesslyprehistoryelasticitylachrymoseblissfullyvirtuositypresbyterydiscretelydepositoryresolutelysoothsayerhypotenuseyardmasterrigorouslyconverselysuccinctlydecisivelystubbornlyswimminglysingularlyfalsifyingselflesslymystifyingshantytownflawlesslyrepositoryfreakishlycolossallysynecdochehumorouslyoverstayedmastectomyinsolvencysynthesizepropensitystrikinglygastronomysquirrellypositivityperversitylaryngitisdistillerysheepishlypolynesianabyssinianhypnotisedpityriasissyndactylyplayhousessymbolisedasphyxiateecchymosistastefullyfeverishlystraightlymindlesslyrestlesslyspecifyingparalysingschooldaysperilouslyurinalysisasymmetricwondrouslypolygamistshamefullymusicalitybusybodiesdisharmonyseychellesyoungstownskywritingtransitoryascendancyabstractlybloomsburydevilishlyseismologychildishlyseamlesslyperverselysyphiliticproslaverysalicylatepleasantrystringencysmashinglyepididymiswordlesslylifelesslyisocyanatesystemizedsociopathytiresomelypossessoryparoxysmalsanctimonyunpriestlyconsumedlyhypertensepitilesslyfiendishlyharmlesslycandyflosssuicidallysynthesisedepositarymicroscopymetaphysiccryogenicsmusicologyhypersonicreassemblytrolleybusepisiotomytunelesslyflyswatterluminositypolygamousresiliencymisogynousgymnasiumsjoyfulnessgyroscopicwastefullypleasinglymultistoryyesteryearsportinglysyncopatedpsilocybinpolytheismaccusatorypresbyopiainsolentlygruesomelyspasticitydeservedlyinfamouslymanifestlyhypodermispersonablystridentlyunicyclistyellownesshypoplasiaminstrelsymysophiliahemoptysisdesolatelyeffusivelysoothinglyinsanitaryinsatiablyunsurveyedcurtseyingmycologistdysarthriaspirometrymycoplasmapolytheistspotlesslydysprosiumspankinglyepiphysealepiphysialcrashinglyvirtuouslychrysoliteheedlesslytrustinglysatyagrahaunshakablysatyriasiscystoscopyescapologyhaemolysismeasurablyclownishlystudiouslyhobbyhorsegorgeouslyclydesdaletypesettermagistracyplayschoolsensuouslyunsteadilymysticallystupefyingoppositelymyastheniacrushinglyimmodestlyplasticitypantywaistravenouslypreciouslylistlesslyseasonallyhesitantlydeclassifybiophysicssymbolicalsedulouslyhypophysisthucydidesdespicablyspiritedlydesirouslyscornfullysynchronicinsensiblyfantasyingdyskinesiasymposiumssneeringlyspitefullysolubilityboastfullymiscellanysycophancygeophysicssinisterlyepistolarylonesomelytrotskyitedesignedlysymbolizertimorouslyfestoonerycovetouslyascendencysanguinaryhypostasischurlishlysanguinityjoyousnessmonogynoustuberosityincessancyslantinglysphericityabstrusitysynaeresislopsidedlyunsuitablyobservablyderisivelyaneurysmallusciouslycomposedlysynchronaloversupplyvalorouslyexpositoryundismayedlengthwayslyophilisepreciositysyncretisesyncretizebathyscaphtortuosityimposinglydisyllableinsipiditysynergeticinsistencyankylosaurinsobrietysnobbishlyepiscopacyprecursorysomatotypesynopticaldetestablysaprophyteviscometrysalabilityblastocystcrystalizesynthesistbaptisterypensionarypanegyristresolidifyphenocrystholidayerscubbyholesunderplaystympaniteszygomaticscrayonistscyclostomeschoolboyspyrolusitethievishlysandpaperyratepayersslothfullycytostaticclepsydrasmovelesslygraywackessymboliseshypothesesxylophonespolypariesdecorouslysulfhydrylabsorbencydisutilitysymbolistsmonolayerscollyriumsandrogynessymbolizesabrasivelykeypunchestrickishlyexiguouslyswooninglysymbollingplasmolyzeprankishlyassertedlydelusivelyhydrolytesdisloyallycatalyzersanalysandshoneymoonsscowlinglydisputablykeystrokedaversivelykanamycinsobeisantlysonglesslydehydrateshydrolyzescheapishlydyskineticrhymesterscurrycombssymphonisthypnotizesvaricosityphenotypesesurientlyreanalysestristfullyphysicistsmuscularlyreanalysisunsayablesreanalyzesheteronymsdisquietlypelycosaurdialysatesadipocytesgynandrousbootlesslyivorybillsportrayalsabstruselypolyploidsportrayersgynarchiessympathiespressinglyqualmishlycocksurelyexocytosedstiflinglyexocytosispiggybacksdyspepsiesreclassifyspeciouslydialyzatesflyweightsslavocracyscallywagspresumedlyresiduallythrowawaysbiorhythmshydropathscoryphaeuscymbalistspartygoersspuriouslysyncarpousdolorouslyautopsyingmisplayingdysphoriashypocritesdysplasiasrhytidomessluggardlyfactiouslyconclusorytympanistsprototypespresurgerysynergismspanegyricsrepaymentsrestudyingredisplayspussyfootsoxyuriasesaccursedlygynophoresmisemploysoxyuriasisrehydratessubacutelysportivelyhalophytessybaritismosteocytessuretyshipskylarkerscyanotypeshypabyssalsluicewaysamnestyingnebulouslyprepenselyghastfullybioassayedcarrybacksbryologiesbyproductsskylightedhybridismsstalwartlyayurvedicsdefensiblyhydropsiesbryophytessolvolyticsneakinglymicropyleshydrolysisunderstoryholystonescarryoversasymptoticglycerideshybridizessalutarilyformlesslycybercastssubjacencyhairstylesshrievaltypolyestersskyrocketscybernatesdisplayersvisionallyskeletallysocietallysubvocallydisplayingantonymousmicrocytestypestylesaerophytesconfusedlybyssinosesbyssinosissystemizesjackasseryambrotypesbystanderslyricisingmycologiesmyeloblastjourneyersmythicizespristinelyecosystemsunchastitymycophileswindlesslyglycolyseshydrangeasscenicallysycophantsbustlinglynamelesslypyroceramsclaystonesvoyeurismslaypersonsglycosuriavaporouslydisarrayedaccessiblyhamadryadsleiomyomasgyrfalconsresponsoryviewlesslyquarryingsmythmakerscanyoneershorseplayshyperbolesboycotterscanyoningsmycotoxinsembaymentsactomyosinallotypiesresprayingroysteringsweepinglysanguinelyresurveyedurinalysesbodyguardsmyelitidesporphyrinsghoulishlycholecystsfootlesslybrickyardscastratorysemiyearlypolygraphsjoyfullestlinotyperslustrouslysynopsizedsyllabizessynopsizespostsyncedtypologiesappositelypyrolysateswirlinglycystocarpsstandardlysubsystemssynostosessynostosisyardsticksselenologypolyhistorsanitarilyplatypusesyounglingsparaphysesacetylenesswishinglypachydermsworrywartsyoungstersskittishlyenjoymentsdensifyingmesenchymeallusivelysubtenancydissatisfymanslayerswayfaringsnebulositygladsomelyblushinglysyllogistsecchymosesproenzymesreservedlysoullesslyplayactorssoundinglysluggishlysyllogizeslabyrinthstyranniseddynamisticcytologistjellybeanssuperheavytigerishlytyrannisesillusorilyeuthyroidsbicyclistsdrysaltershyphenatestyrannizesfreestylesluminouslytoilsomelycataclysmsdisobeyersschizogonygymnospermdisobeyingplayfieldsenthymemessannyasinsannoyancesproselytedhypostomespicayunishproselytessynthetasestylebookstyrocidinsferryboatssyntheticsprespecifygraybeardshyphenlesspolymorphslachrymalsserigraphypolymyxinsanthocyansbuckyballscrayfishesdairymaidsplaymakerscopolymersgrayhoundsautolysingisoenzymesautolysinsisoenzymicresignedlycumbrouslymonogyniessweetishlymesophyticimpassiblyphosphorylcollotypescytoplasmscyclostylecytoplastsdynorphinsphyllopodsmartyrdomskeybuttonsstylisticstransiencygreyhoundsstagnantlygraynessespriggishlycyclonitesplaythingsnurserymandestroyersthymidinesendostylesstylitismsdestroyingmyologistssyncretistexcusatoryclepsydraeconsonancycostlesslycrazyweedsserotypingmisogyniesgreynesseshygrostatscanorouslycrescivelysymmetrizeeuonymusesclerestorywyandottesgraywatersxylophagesathrocyteshydrolasesthymocyteszygositieshoneycombsgypsophilapericyclessemidryingmoneywortssymbolismspaymastersplasmogamyhaplotypesbuoyanciesjollyboatsmartyrizesstylobatesvenomouslyboyishnessshinneyingsonographymutinouslymyopathiesthyratronsforsythiaszygosporesdidynamiesnaugahydesnematocystwyliecoatsgunnysackscytotoxinsflybridgesgigacyclesytterbiumspyroxylinscaptiouslypolyamidesxylotomiespolygynoussyndactylsthyristorsslashinglyosmolalitypolyaminesresonantlystereologyhydrolysessquinnyingstylolitessuperiorlyinterplaysdyscrasiasosmolarityyellowlegspolyanthaspoppycockssonorouslyencystmentgalabiyahsanhydridesremissiblycycloramassyndesisesadhesivelypoppyheadssewabilitytypescriptanhydritesscarifyingsubtotallyhyperlinkscountryishspyglassesmissiologydoohickeysdysentericpolyphasiccolocynthsthyroxinespolymerasefearsomelymyositisesemissivityentophytesspymastersspaciouslydivisivelydysgenesesbabyproofskeystrokesdiseconomyhypnotismscarbamoylsryegrassesmyosotisespolymerisehypnotistspermalloyspolyphonessyphilisesthysanuranhypotoniascockneyishstylopodiacockneyismzymologiespyorrhoeasnauseouslyobsoletelydyslecticshollyhocksbreezewayslongsomelysurveyingssyndicatespaddywackspartisanlycondylomasphysiciansamplidynesjonnycakesrisibilityinsularitypresbyopeshemicyclesleukocytessquirarchysymmetriescataphyllszymometersusuriouslyflyroddersphysickingpyralididshypoxemiaspsephologyjambalayascyclotronsoxycodonescyanamidesmethylasesoxygenasesperigynieshylozoismsfairyhoodsperigynousgalactosylgynandriesmethylatesoxygenatesparalyticshypoblastsnurserymenfairylandsbigamouslyhylozoistsrifamycinsflyspeckedpopulouslyastrocytesdoomsayersastrocyticparalyzerssaccharifysuperlyingdoomsayingpolychetesantonymiessymposiastphenyleneshypocaustsdollybirdsdoomsdayerpresbytersmethylenesswordplaysdiaphyseallymphaticstwaybladesabeyanciesdiaphysialstyrofoamssympathinscorybantesmesophyllspastorallypolypodiesinsociablychirimoyassecludedlymesophytesexocytosesautophytesstereotypyneodymiumsoxygenizespelecypodsdayflowerssugarberrysynecologyphenytoinsninhydrinsdyspepsiasoxygenlessgesturallyhyperopiasrhythmistssubsocietyperilymphshologyniessassywoodscohesivelyastrometrygyniatriesbisexuallykymographsskybridgeshydroniumssporophyllstericallysporophytedyspepticsrhythmizesdysphagiaspyranosideshandygaffphototypesyeastinesscoenocytessufferablysympatriesskydivingsmyrmidonesincisivelypolyptychscymbaleersdysphasiasmelaphyresmyrobalansdysphasicshymnodistsbotrytisesshylockingsnappishlytricyclicsdysphoniasbayberrieshypocotylssporocystsmosaicallysubvarietyexoenzymescandygramscryogeniestonelesslyxenocrystsperimysiumcandytuftscherimoyasspinsterlysymphoniesdithyrambsascomyceteapoenzymescaconymiesholophytesinsolvablysensuositycymbidiumsdisemploysticklishlyayahuascasslatternlyhypsometerunsociallygovernessyhypodermascryometersmetonymiesmonkeypodsyuppiedomspyrethrinsdayspringssterlinglysupernallyinsecurelyayatollahshysteresesseminuditymonkeypotssymphysealpolysemiesgynophobescounterspysolitarilysynergistsoutstayingpyrethrumshysteretickilocyclessemiweeklytachylitesgeyseritesskyjackersunctuouslypolycystichyperpneasskyjackingsymphysialtachylytespresurveysgraspinglylathyrismscryophytesswaybackedmystagoguenaysayingspolysomicsdayworkersmusicianlysporophylscymographshysteresishistolyseslawyeringsmyasthenicclannishlyheliotypeshistolysisfecklesslysentientlyskylarkingtimelesslyflunkyismsyohimbinesmitomycinsmollymawkseucaryotesbackwoodsyjayhawkerscyanuratespuppyhoodscymophanesbryologistamygdalinscryoprobesdysthymiashybridistsmysticetesjaywalkersmysticismsdysthymicsasexualitypolydipsicpyridoxalssolvolysesmegacyclessolvolysiscryoscopeshairsprayshemizygousholystonedrescissorydysgenesiscryoscopicsymposiacsoysteringspolysemousmystifierspyridoxinsacyclovirshypallagescryostaticsphygmusescybercafeshistiocyteparonymousamblyopiashybridomaswavelesslyyellowfinsmisallyingmisstylingacylationsmosquitoeydystrophicglycerinessibilantlysyncopatorphytolithsmolybdatesasynchronyparamylumsamyloplasthypogynieshydathodeshypogynouseurythmicslovelesslysynkaryonsamylopsinshydroseressportfullycybernautsmetastablysyncretismpharyngalsunchastelypolygamieshydrosoliccourtyardsmycoflorastypewritespolyteniesdysphemismskysurfersamyotoniasasymptoteserysipelasjunglegymsskysurfingmacrocystssystemlessmacrocytessomatologymeromyosindisyllabicisopropylscoyotillossquarishlydasymeterstortuouslypsilophytezettabytescotyledonsdwarfishlypolythenesdysplasticswinginglypennywortshydrospacestockyardshypomaniascyberpornssynaeresesanisotropyuxoriouslysegmentarycyberpunkshypomanicscotylosaursyndicatortyphlosolehemolymphsstableboysskywritersglycolysiscybersexesasyndetonshomonymiessheepberryhydrostatsessayisticabsorbancypropylenespersonaltyclaytoniasskywritteneyebrightshemolysinscyprinoidssynagoguesladyfishesapophysealphonotypespropyliteshypomorphsmycorhizassynalephasroyalmastscopyrightscryptogamssynaloephanonsystemsparanymphsscratchilylogotypiessniffishlyeyednessesankylosingbusynessesphotolysesphotolysishyperbolascybrarianscysteaminemonocotylseurythermsphytotronsglycosideslectotypesglycosidichemoptysesbreakawaysaccusinglytortiouslyarytenoidsparaphysislysimeterssynonymieseurythmiesbodyboardslysimetriccycadeoidssprynessesphotolyzespolywatersbibulouslyboyfriendsyeomanriesautotypieshyponymiesendolymphshydrationspresbyopicradiolysischrysalidscysticercitaxpayingsepicalyceserythrismsphrensyingpolygonieswallyballsmetaxylemssubpotencyepicalyxesmydriaticsepiphytismerythritespityriasesfusibilitygamesomelypolygonumswallydragsbodycheckslysogeniesstenotypedmisassayedstrongylessynonymizecocatalystcyclamatesxerophyteshydrazideschatoyantsrhinoscopylysogeniseplanlesslyporphyriashydrazinesstenotypesosteopathycornerwaysmonocyclesporphyriescryptonymsamebocytesgyropilotshydroxideskerseymeremonorhymessynonymistnewsweeklynonplayerslysogenizegyroplanessynonymitynymphalidspsychoticsputtyrootscellarwayskindlesslysuspensorymyelocytestypographsgyroscopeshypophysessyllabismspyrologiesscurrilityseasonablyspeciositycystinuriasyllabizedbodysurfedexercyclesviperouslybodysurferhypertextslaryngealscystitidesnymphetteseyeopenerspolygyniescliquishlyyottabytesdandyishlymyelogramstypologistcausewayedsyllablingtrustfullybellyachesguayaberassagittallyreversiblysteelyardssuppletorybellybandssemeiologycystocelesspeleologyeyepoppersjoypoppersarchetypesstaticallymiscopyingoligopsonyorismologyerythrosinacetylatesreadymadeshypoploidskaryosomesshrewishlystorybookssyllabusesconsistorybipyramidsscorifyingcausticityhydrocastssecularityradiolyseshydroceleskaryotypescystolithssubeconomyendophytesviscerallyhousewifeyjoyridingscystoscopestinginglysyntacticsmisrelyingdryasdustsoversimplyyesterdayspolyanthusmayflowerssyntagmatapostulancypresidiarywomanishlypyrolyzersstepfamilyhospitablyhydrozoanssyllogismspennycresssyncarpiesuppitynesspachyteneschrysotilerussifyingeyestrainspolyimidesyesterevesberylliumseyestringsclearstorygraveyardsblimpishlymayoressesdynametersescalatoryantimonylsscyphozoanspirogyraspyromaniashypercubeshypostasescopaymentsmayorshipssuperalloysyllogizedtrichocystpolylysineyourselvesrusticallytoponymiesanchylosedawaynesseshyaloplasmtoponymistanchylosespyrometersstatocystsichthyoidssatyriasesspectrallyspatialitymyxamoebasnumerouslyeukaryotesantimycinsillusivelystinkinglypresignifypuromycinshokypokiescyclizinesstrathspeyversifyingsardonyxesviscountcyhyperemiashomonymousdynamitersearlywoodstrihybridshypostaticsociometryfreestylercityscapesmyxoedemasdrysalteryjellyrollslifestylesdictyosomesperryliteminelayersepisomallyunderclaysphylaxisessalutatoryferrotypesperistylesphylesisespterygiumsseismicitysuzeraintysylvanitespseudonymshydrofoilscaryatidessupposablymyxomatousswitchyardtinkertoyspterygoidsemphysemasoutjockeyspargylinesphyllariespolymerismantistylescytogeniesemphysemicpyelitisespyelogramshygienistsscabrouslyplaygoingsphotoplayspolydipsiacytokininsnonlawyersplaygroupsspecularlycytologieshypocorismecdysiastssemicolonyphagocyteshighflyershypostylesmyofibrilstactlesslycytolysinsdynamotorsthylacinesheterocystraygrassessylvinitesthylakoidsmeasuredlyautolysatebillycocksgoldeneyesmyoglobinsunsociablyeriophyidsevonymusesgrayfishesroundelaysleucocytesshaggymaneosculatorytyrosinasegainsayersxylographsimpassablymistrystedhomozygoussuperhypedmesomorphyuropygiumsgainsayingsuperhypessyncopatesfancyworksbuckytubessynthetistgamynesseszincolysissomnolencysymbolisersymbionticmesophyronpyrostaticcyclosoruscyclolithsxyloidinessclerotomycytopeniassyringefuldaisywheelsynthetizewestwardlyxylologiesgreybeardsypsiliformsyrrhaptestympanitismisogynismhypericumsadactylismunctuosityptyalisingquaestuaryhushabyingadactylousdyophysitepranayamasboastinglychemitypesdolesomelytolypeutesperomyscushypnoidisepsychopompscoffinglysnarlinglysnobocracyobservancypropenselypygostylespsychopsistewkesburywykehamistxylometerssevenpennypanchayatsamaryllidshexastylescagynessesspreagheryalbespynespolyominosgreylistedzygophytesdisk-jockeyclistogamymartyrisedheleodytesmyomancieswhitsundaypentastylelackadaisymartyrisesdisallyingdiscursorysynthronusdyothelismmenyanthesgymnasiastkeyloggerssymmetriseedaciouslyfabulositybrandysnapmastodyniacrocodyluschromakeysgnoseologyprocaryonspodilymbuspyrophorusshellycoatsidereallysquint-eyednotaryshipvaritypistgreystoneslaryngitessilver-graystaphylinemooseyardskitakyushuprosifyingsizzlinglysilver-greydisamenityuranalysisgnosiologygreywackeszygospermsresolvedlystylographpaynimrieszygosphenepaederastybossybootssyntonisedtonsillaryplasmolysegipsyhoodsrallycrossdisanalogyhypopachussyntonisespyknosomesimmisciblyquiescencyjollyheadsmyophiliesxylorimbasytterbitesonobrychiszygosporicchemonastyscolytidaestaphylomadidynamousmyophiloushyoscyamusdysbindinsphysalisesgipsywortspolygynistcensurablyseventy-onestaymakersspiny-edgedstegomyiasacronymoussyntonizedpyrrhicisthydrolysedcatalyserssacrifyingsyntonizesdoddypollsxylotomistgymnosophshydrolyserpsychotriaseventy-sixuranalysesvichyssoiscatalysingsynderesestallyshopsxylotomouscosmolatrypursuantlyseventy-twospeedfullysynderesisdyschroiaspercursoryhomoblastystyloliticdieciouslyanhydrasescomatoselyoverrashlyphysiatricpursuinglycatholytesstylometrydyscrasiteampholytessarcostyledispurveyslithocystsstylophoneanhydrosisanalysablerybaudryesscaldberrypyogenesescordylinessubshrubbyichthyosispaysagistsvitreositypyogenesiskeystoningstickybeakstylopisedmonoxylonsdibasicitysyndeticalsypheringsparastichyunsisterlypolyaxialshypnotisesplayscriptscyphiformstylopisesmonoxylousoverstayervitreouslyskulkinglymonozygousbradyseismklondykersgastrocybehoneybellsswellinglydysgraphicmesognathystylopizedsubsidencysurveyablethyrsoidalmysophobiagynaeceumsscheminglystylopizessyphilisedeximiouslypolybasitemysophobicatmolysingprozymiteshoneytrapsseducinglysquiralitydasyatidaedecrassifysymphonisesurveyanceenneastylefasciatelyhypermartshoydenismsisohyetalsscythelikefoetoscopystraylingsstrychniassymphonizehydrobatesprincesslyzymologiststarchedlymonogynistdasyproctahylophytessilentiarysystemisersymmetrianunsavorilyhylotheismsyphilizedpistillarysystemizernecroscopysyphilizestopsy-turvyflypitchesreanalysedhylotheiststony-brokesyndicshipflypostingphysicismspsychiaterpyracanthsspagyricalsnakeberrysooty-blackstellatelystrychnismsymphysionhackneyismhalloysitepanonychushylotomousstealinglyparalyserssneakishlydisglorifytetrastyleparleyvoosfairyflossbusybodieddissonancyuseabilitypolypidomsdasyuridaescoldinglyspagyriststaillesslywhydunnitspsychicismsexagenarybluish-graywithywindsmyringitissyphilomasbluish-greyflyscreensgrumpishlygynandrismpsychicistparisologydyaus-pitarquasi-royalstypticitydicacodylstycoonatescalystegiaphysiocratgarryowenssouthernlystereotomydialysableanonymisedzircalloysslaughterydaycentressubtypicalsueabilitydysmorphicforesayingpolychasiaanonymisesintrorselycloddishlyfairytalesparablepsychylaceouspyramidistplasmacytemoygashelsambystomidtreatylessoxygenisedspherocyteoxygeniserbillystickflystrikesvascularlyivorywoodsmyrioramasanonymizespolyoicouscyanidingsmyrioscopeoxygenisesmetacyesisdissuasorypentylenesastrolatrypolychrestantrorselypresbytismhypernovasstarry-eyedpolypodouspowerplayspyramidonsdacrymycesrhythmisedlactophrysoyster-fishhydronautsdyer's-broominpaymentsrhythmisesskimminglymelanositydyspathiesvesicatoryharassedlydacryocysttoyishnesslophodytesmayakovskiassignablyhypsophobesoberinglyfibrocytesgyniatricslithophysacorylopsescymagraphstipsifyingacatalepsyxanthoxylshyperosmiagalsworthylithophysesyringitisblockishlyhypsophyllinsolidityseminalitysecond-yearsororiallyuncousinlyunanalysedaplysiidaeunbiasedlyoysterfishhyalinisedchurchwayssimulatoryplastogamyzizyphuseshyalinisesrhythmlessstrivinglydysphagiesbaby-sitteriridocyteskyphosidaesynaptomyssyneidesespadymelonsphantastrylucklesslysyneidesistricyclerscynopterushistiologyizvestiyassnortinglycryocablespersuasoryhyalinizesscolytoidsskimpinglysqualiditysymphiliespastrycookzelotypiasphrynosomageothlypisdactylistssymphilismpyreneitesrhythmuseseastwardlykyrgyzstanhornyheadssphyrnidaedebasinglyhypozeuxissymphiloustricyclistderisorilyleastawaysslipperilyskiagraphysporocyteshypericismhypsiglenagolomynkashornywinkscoryphenesstirringlymyrtaceoussatanologyblackishlyskinflintysubaciditysymphonionstreetboysmonkeyismssynergiseddyspraxiasdryopterisfast-flyinghypsometrysynergisesascomycotaunswayableflexuouslyphoneynessayahuascossymphylousyiddishismcanyonsidepay-stationtumulosityhairdryershyalonemasbrondyronsgargoylismdecastylespanegyriesdynamitistspeakinglycymiferousmystagogicoverwiselypanegyriseflunkeyishprayerlessprocrypseskirkyairdscryophorussynergizedflunkeyismglaucouslynyctanassaprocrypsishyoplastrasynergizeshysterickylacunositystrainedlyhysteritisseptectomyfishifyingpoetasterygynostemiaregistraryspiceberrysybaritishsymphysticnycticebuslathyrusesgonioscopystoopinglyunsymmetrypolysomiesrecyclateshybridisedfrumpishlygenyonemusmystagogusamylaceousixobrychustridymitespostliminyhybridiseroctastylesunsympathyanswerablyxenoglossybaryspherecaprylatesmollyhawksfrabjouslyareostyleshistolytichybridisesseemlyhedsscatophagysymplasticdysthesiaspolystylarhypogaeousslipsloppysquamoselystockishlyadjustablyglycaemiaspsychogonyshamiyanahdysthymiacpsychogramisopachyterecyclistsamylolysisthylacinustourneyersunsyllabicbawdyhouseunsoliditybiosurgerycohyponymssquamositydioicouslyhypalgesiafifty-sevenstylomecontimenoguysunsymbolicmycostatinpolysemantsquamouslyoverswayedtypecastermycosterolbreaksawayhypalgesicsulphinylsunsanctifyparonomasypatulouslyallonymousspellinglysyngenesesusurpatoryhypogenoussyngenesistachypneasunusefullyhydropultsdysgraphiasteatopygasubdeanerymoskonfytsdiophysitesyngeneticparonymiescarrytalesstillatorydystopiansploughboysnewsagencychasmogamydystrophiaengyscopessculduddryfaldistoryusurpinglyamylolysesnosy-parkercurly-headsunsatiablyculdoscopyhydroscopelinguistrystartinglysunken-eyedmythicisedsystemisedconsectaryskippinglymythiciserdystrophinfishwifelyyammeringshedyphaneshydantoinsscampishlycynomolgussystemisesbathyergusgallabiyasyellowiestbathylitesbesottedlybyssaceousseethinglymycobiontsmythiciseszygnemalesdisfluencysplotchilystabbinglystrokeplaysubjectifytrioxygensgypsyhoodssabulosityulcerouslylyre-shapedfishybackswhillywhaspyritisingbathylithsmistakablymythicismspennylandszygocactusphenacomyscoyishnessoctogynousbathyscapepolygamiseglycocollssibilatorycynopodousmolybdosesdesolatorymythicistseucryphiasmetaphysisclayeynesshairybacksscrapyardsmolybdosisabsolutorygypsywortspasigraphyhyperrealskailyairdssulphonylsautoplastybisymmetryhydrosomalfeateouslybaselesslyinerasablycopygraphsjockeyismsmeronymiesdasypaedalsyndetikontyphaceousasynarteteherrymentshydraemiasinerasiblyinsalutarysynoecetespalsy-walsyhydrosomesjockeyshipjusticiarylow-densitypolytocousisopycnalskryometersanchylosishistoryingroyalisingparoxysmicmatsyendrapredestinypropulsoryresinouslybytownitesisopycnicschessyliteself-styledsynoecisedhomebuyersroyalisticstedfastlyaeschyleansynoecisesshandrydanessayettescelioscopypygoscelisdiffusedlysynoecismsunsensiblynecrolysisasynergiasenhydritesvaporositypolygeniesasynergieshemolysingsynoecizedtyphoidinslysichitonpolygenismasyntactickeelyvinessynoecizesbrickclaysreversedlyjouysaunceenhydroseslysichitumpolygenisthaemocytesquestinglydextrouslyscavengerysniffinglyabsorbedlyasphyxiantasystolismpyroclastshyponasticnyctalopestuboplastyozonolysespolygenoussuperphylaozonolysisdichromasydytiscidaeburleycuespylodictusseparatorycopytakerssynoeketesphotolysedapophysatehandyworksretrorselysitophylusdickybirdslysimachialysergidessynandriumapophysialhydrotaxesjovysauncesynandroushydrotaxisoncolyticsadvisatoryhydrastineresistiblysmirkinglyspodomancynyctinastyoctostyleseudialytescessionarysciophyteslysigenousdiapyeticsdaisy-chainsciophyticcystectomysyllabariapolyvinylshaemolysestalbotypesprokaryonssilvereyessynonymiseerythrinaslysimachuspolyglottsglycosurichomoplasmypyocyanasesalicylismmetrostylestoriologywishy-washyhesitatorycalotypistroystererssyngnathussyllabicalthysanuronprokaryotschalybitessematologyconsultoryosteolysisroysteroussynanthiesopposinglypausefullyvixenishlyperistylarhomoplastysynanthouseyeleteersfadelesslyarraymentsassuminglypyrolaterschrysanthsstenotyperstimulancyhypertonustayassuidsdickey-seattayberriespheasantryhaymakingssynoecioustemerouslyrusty-brownmegaphyllsstenotypicstormfullysynapheiastabbyhoodsreasonedlycystideanssulphurylsosteophytepyrolisinghydrovaneskaryogramsleisurablymyelitisessyllabisednymphaeumsporphyriosgainlesslysubsultorysyllabisessynopsisedtubulouslyalectryonsbodyshellsstackyardsdiachylonssynopsisesaspiratorycystophorahypophygesmetecdysescystinosesprotensityrevestiaryradioscopymetecdysiscystinosisstrabotomydiachylumsviperishlybaldmoneyschrysophanautocyclesazygosporedisc-jockeyrock-steadyecstasyinggraciosityaspiringlyhastefullycruisewaysdandyfunkssynaptasesjayshullahorinasallybobbysockslyssavirusphotonastycystitisesmythomaneshyemoschusbobbysoxerassurgencyhercyniteskaryolysesfly-fishingdisposedlyperviouslyporphyrousproteolyseleylandiissynapticaldismaylinggyrostaticdandypratsdigestedlysynoptiststypomaniashypoplastypuissantlyhematocystmahayanismabstinencyphthisickypyrolysersdigestiblysynoviallymahayanistserjeantrysynarchiesassythmentpyrolysingsoughinglyeyeshadowsarhythmiasgyrovaguesstoryettesurinoscopyglossinglycyclicismsdrayhorsesperishablymussorgskymyosarcomachrysopsishypopnoeasmassymoresspoliatorystorylinestachypleustryingnessreaedifyesrosy-purplecolourwayshay-scentedsynastriesacetylidessyllogisedastacologysleepy-eyednystagmoidcoryanthesspoylefullspulyieingdahabiyahssyllogisessynaxarionphycocyansyesterevenguberniyasmansionaryhimalayishwrongouslyhelophyteshexagynoussucculencydictyogensmythopoetsdismissoryunshakenlygastrologycondenserycystostomydahabiyehsnotoryctuschiyogamiskaryolysisproembryossatyagrahisiderocytedensimetryhouyhnhnmsecchymosedtrendyismsneurolysinyestermornracemoselyburramysesconsignifymylohyoidskaryoplasmprettyismshieroscopysparkishlyhypnotiserdynamicistexpansiblyzanthoxylsostryopsisracemouslypresent-daycolposcopysyllogiserfeverouslypolylemmasnumerositycorylopsiscrystaliseinvasivelybountyhedsmiscreancysupplymentnosographytoponymicsceylanitesspray-driedblastocytefarinoselyone-sidedlypseudologyceylonitessatyresquespondylousstrickenlysyntenosesdynamisingpolymastiaforty-firstmylonitisesyntenosismalaclemysglossologysatyresseschlamydiassyllogizerpolymasticsepticallyhaemolysinsyntereseslawyerbushtyranniserstatolatrysumerologysynteresishinayanismdiphylloushygroscopesylphidineallaymentsisocrymalshinayanistsyntexisesgnashinglysaucer-eyedgymnopilusectophytespararhymesplaybussesbridlewaysmonostylarpassionaryhomotypieslifestylerdiphysitesyouthheadsisocyanideforty-sevensnappinglysnubbinglydessyatineenvoyshipsyouthhoodspycnosporeforty-sixthsomniloquymistraynedpycnostylepolycirrusbrachyaxesforsakenlypolymeriespterygialsbrachyaxissixty-eightgoose-tansygymnosophysynthetismarchitypessixty-fifthmyoblastickallitypesstichologymatroyshkasylvilagusgastrotomypyrophoneshyphenisedsomniatorypollyannashyphenisesmatryoshkadecagynoussylvestralnostopathyoscitantlyzygantrumscalypterasscabridityhylocereusmandylionsmatryoshkimissayingsparhypatesprehensoryhyphenismshypostressrocksteadykiddywinkssixty-sevenstercorarystintinglymistresslybunyavirusproselyticpteryloseshurtlesslyblindstoryhygristorscyclogirosstatutablystridewaysimpulse-buypterylosiseuphrosynesixty-threemastopathypolymerousaristologyxylogenoushomostyledthwartwaystriptyqueshygrochasypyrogenousshoutinglyhomostylictightishlyantisyzygyhygrodeikshyphenizessallyportssynclasticnephthytisrealisablyichthyosessynclinalspeerlesslyunisonallyyatteringsspongologysymbolatryneurolysesdynasticalphyllodiessalmagundyliterosityslanginglymesitylenesynthetiseneurolysistrotskyismwayzgoosesaraeostylerustlinglycytometerstrotskyistaeolipylesfriskinglyagonisedlypokerishlyisodynamicclashinglyspuriositystannotypetyropittasplaylistedpraisinglypyroscopesguessinglycognisablyhydramnioszincolysesjolleyingsklendusity
Phrases (331)
yves tanguyshort storygenus lygusfleur-de-lysepoxy resinbrya ebenusbrandy nosecygnus olorroot systemmoshe dayanfield pansygenus khayaparis daisygenus cycassugar candylead astraysugar daddypastry cookvery softlyjohn wesleysugar syrupunix systembaby's dummyheavy swellsmart moneyisle of skyetone systemwendy housecase-by-casespanish flygenus physabrown studylist systemexpress joybing crosbyeaster lilyhenry jamessean o'caseyhouse partycrossed eyebeauty spotst. polycarpcurry saucesubway faremaster copyfloppy diskroy orbisontake it easyfirst of mayleo tolstoynorse deitybobby jonesmaple syrupbasil thymethomas grayjames joycegenus caryapenny grasscity limitsempty wordsdesert lynxforty winkssnow flurrylawyer bushfairy storyshadow playgenus typhalay hands onjumper staysafety islesafety locksidney webblay waste toby all meansstep-by-stepplay trickshelen hayescrown daisydwarf daisywalt disneyin a pig's eyestay-at-homeholy personsystem callsilver citysea lampreysnowy egretsnowy herongyps fulvusmary stuartiris familyholy spiritwillie maysbessy cercasteady downhoney crispsour cherryloony toonstin pyritessam goldwynseed oysterdragon's eyeoxygen maskswamp buggywhite daisynancy astoros hyoideumdry masonrydry measuredummy whistemery stonemoss familyprivy pursecow parsleyyemeni filsdry mustardstony coralperry masonbaby bustercanary seedpastry cartruby spinelspirit awayvery pistolwelsh poppyst john's dayvena azygosyerba mansayerba santaoyster bankpine sawyersentry dutygenus bryumsun-ray lampchinese yamalloy steeloyster crabmemory lossturkey stewsea trifolywoman's bodyoyster parkalkyd resinbaby's tearschalcis flyoyster stewschool yeargenus xyrisivory coastdata systemgenus yuccajohnny cashcownose raydirty storygenus nyssashank's ponysibley tentpalm sundayshanks' ponygenus ptyassunday bestkeyhole sawenglish ivyrush familyfalse calyxallyl resinstyle sheetjersey cityjersey fernlucius claykansas cityjersey pinecrazy horsemass energymother's boycrazy housecutty stoolqin dynastygenus layiamother's dayrose familysaint cyrilbinary starst. gregory icasey jonessally forthmarsh buggyrest energyyeast doughpayne's graygenus pyruscelery saltpayne's greycelery seedjury systemcoyote bushcurly grassenglish yewfat tuesdaychild's bodyeye diseasechild's playsurvey mileart historylady's lacesbay scallopstroke playyellow basslady's smockeye surgerytoy soldierlens systemcandy storefancy dresstoy spanielfancy goodsthe holy seebeauty bushpygmy mousesquare awaysunray lampsupply linesupply shipcounty seatbeauty shopwei dynastyduc de sullyside by sideswedish ryeshoofly piegenus oryzacorn spurryfather's dayway stationkhyber passcorn whiskyfly castingbigeye scaddusky sharkhenry sweetfanny adamsdaisy wheelhan dynastygas companyyellow irisspotted raycystic veinshowy daisyquai d'orsaysquare yardroy wilkinsfuel systembus companymerry bellsdowny chessfunny housekrebs cyclefunny storywood's alloysell-by datesand cherrymurphy's lawmalt whiskyhershey barroyal flushgenus hydraroyal housepeyton rousnews agencycarson citysleepy dickpenny stockeasy streetfile systemsand myrtledawson citycave myotissolar arrayice crystalbush lawyerparsley hawsum of moneycheese traycrystal setcrystal teaflying fishspray paintsand spurryblack sallytrophy casewhiskey jugsafety archblue sky lawsafety beltwhisky neatyellow spothessian flysafety bikewhisky sourgenus dryasday nurserysafety boltprickly ashazygos veinrye whiskeyfiscal yearsafety fusebushy asteroxeye daisypatty shellsea chanteyphysics labsafety lampjames wyattsky marshalwestern yewspinel rubysyrian bearfish familyharvest flysoybean oillay witnesssafety railquick studysurety bondwashing dayplay possumsafety zonevinyl resingenus mysisasa yoelson
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen