Words Containing: Y,P,E,A
(In Any Order)
There are 4,316 words,
3,424 phrases and
1 abbr with
Y,P,E,A in.
Best Scoring Words With: Y,P,E,A
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jaspery | 7 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| apteryx | 7 | 19 | nounn | |||||
noun • nocturnal flightless bird of New Zealand having a long neck and stout legs; only surviving representative of the order Apterygiformes | ||||||||
| pyrexia | 7 | 19 | nounn | |||||
noun • a rise in the temperature of the body; frequently a symptom of infection | ||||||||
| epitaxy | 7 | 19 | nounn | |||||
noun • growing a crystal layer of one mineral on the crystal base of another mineral in such a manner that its crystalline orientation is the same as that of the substrate | ||||||||
| japery | 6 | 18 | nounn | |||||
noun • acting like a clown or buffoon | ||||||||
| empathy | 7 | 17 | nounn | |||||
noun • understanding and entering into another's feelings | ||||||||
| cheaply | 7 | 17 | adverbadv | |||||
adverb • in a stingy manner • in a cheap manner • with little expenditure of money | ||||||||
| preachy | 7 | 17 | adjectiveadj | |||||
adjective satellite • inclined to or marked by tedious moralization | ||||||||
| eparchy | 7 | 17 | nounn | |||||
noun • a province in ancient Greece • a diocese of the Eastern Orthodox Church | ||||||||
| keypads | 7 | 17 | nounn | |||||
noun • a keyboard that is a data input device for computers; arrangement of keys is modelled after the typewriter keyboard | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Abbreviations (1)
payeWords (110)
therapypaymentpenaltyempathyparsleypeabodycheaplysynapsepayableshapelypreachypaisleyplaypenpageboyreapplyaplentypeccarymaypoleplayletdyspneapasskeyplenaryspywarelampreyhyphemadraperysprayeroverpayplagueyrespraypalfreyeparchypenallypatencyadeptly
...View all with 7 letters...
Phrases (7)
pay ratekey palmpay heedper yearcape mayleap daypeg awayWords (207)
egyptianpaycheckjeopardyforeplayanyplaceplaytimeepiphanyweaponrytypefacetaxpayertapestryplaymatespeedwayparalyzepasserbypaperboypatentlypedagogyapoplexyparalysepicayuneunderpayflypaperpyorrheasparselyoverplaytypecastpedantryparleyedeyepatchempyreanasperityplayableroleplaypaygrade
...View all with 8 letters...
Phrases (25)
sea nymphwipe awaycd playercaley peaglory peatea partysea poppydry platerope yardpine away
...View all with 8 letters...
Words (370)
temporarypregnancyspeciallyspecialtyparalyzedprivatelygeographyraspberryblasphemyspeakeasydisplayedpatientlyexemplaryplanetaryportrayedparalysedpantyhosepaternitytelepathysupremacyplayhousearchetypedepravityrepaymentpredatorycarpentryemphysemapolynesiahorseplaypassivelycataplexypageantrycatalepsyhyphenateplaymaker
...View all with 9 letters...
Phrases (48)
rate of payholy placeprayer matprayer rugjockey caphell to payheavy spargenus nypapay packetadp system
...View all with 9 letters...
Words (505)
especiallyapparentlypersonallyscreenplaypeacefullyrepeatedlyseparatelyapocalypsepreferablypresumablyhyperspacespecialitysympathizesleepyheadpleasantlyexpresswayskyscraperexpectancycyberspacepassagewayeucalyptusballplayernarcolepsydispensarypainlesslysympathiseimpeccablyarchetypalhomeopathyapothecaryoverpayingphylloxerapolynesianplayhousesasphyxiate
...View all with 10 letters...
Phrases (86)
private eyefield pansygolf playerapple jellyemery paperprayer bookrole playerkey patternpineal bodygenus physa
...View all with 10 letters...
Words (622)
personalitydesperatelytemporarilypreliminarypotentiallypermanentlysympatheticrespiratoryprematurelyhypothermiahypermarketspontaneityhyperactivediscrepancypterodactylproprietarymetaphysicsperpetuallyimpatientlycomplacencyexplanatoryhorseplayerexploratorypreparatorybathysphereunspeakablyasphyxiatedplayfulnesssympathizerpredictablysphericallypleasurablypythagoreanpeculiarityphraseology
...View all with 11 letters...
Phrases (131)
playing areaspecial juryplayoff gameproperty taxbald cypresspiano playerpolicy makerparaguay teakeep an eye ondinner party
...View all with 11 letters...
Words (597)
specificallycontemporarypennsylvaniachemotherapypassionatelypenitentiarychoreographyencyclopediahypotheticalmetaphysicalperiodicallytransparencypatheticallyinexplicablyperipherallyaromatherapypresbyterianemphaticallyunemployablepsychobabbleappendectomypraiseworthypaleontologyprecariouslyphenomenallyhypnotherapyoceanographyhyperaciditypejorativelycompensatoryconceptuallypsychoactiveradiotherapypolyurethanepsychosexual
...View all with 12 letters...
Phrases (163)
backspace keystaying powerathletic typephantasy lifebarbary sheepanas clypeatapolicy changegenus apteryxreal propertytennis player
...View all with 12 letters...
Words (593)
approximatelyexceptionallyspontaneouslyappropriatelycomplimentaryparliamentarypsychotherapyprecautionarypredominantlyexponentiallyphysiotherapyspectacularlycomparativelycomplementarysupplementarystereotypicalsuperficiallyexpeditionaryhyperactivityunsympatheticencyclopaediapsychoanalyzehypoglycaemicpreliminarilysympathectomydependabilityprovocativelyarchaeopteryxpredominatelyhydrocephalushypercalcemiacryptographerpalaeontologyprostatectomypolycarbonate
...View all with 13 letters...
Phrases (203)
family picidaespiny anteaterbattle of pydnaprivate treatyfamily poaceaebarbary piratetaste propertyplum-yew familygenus bradypusgenus gypaetus
...View all with 13 letters...
Words (466)
professionallyhypotheticallycinematographymetaphoricallyrespectabilitygeographicallyalphabeticallyinterplanetarypancreatectomyelectrotherapyhyperventilatepredictabilitysupernaturallyexperimentallymetaphysicallytelepathicallyphotogrammetryencephalopathyappreciativelysuperficialityappendicectomyphosphorylatedpolymerizationhydropneumaticprovidentiallyorthopedicallyplethysmographdepartmentallyarchetypicallyneuropathologyhydrotherapisttelephonicallypreferentiallypraiseworthilypaleopathology
...View all with 14 letters...
Phrases (230)
family apiaceaepearl mae baileytubal pregnancynavy departmentcapital of kenyavisual propertypolymeric amidepharaoh of egyptprimary featherlacrosse player
...View all with 14 letters...
Words (348)
psychotherapistinappropriatelyphysiotherapistsympathomimeticlymphadenopathydevelopmentallyparentheticallyplenipotentiaryproportionatelytherapeuticallycompassionatelyuncomplimentarymethylphenidateencephalographypostoperativelyunparliamentaryunacceptabilitypolyunsaturatedsympatheticallydispassionatelydemographicallypalaeopathologyeuphemisticallyneuropsychiatrypessimisticallytemperamentallydiphenhydramineperpendicularlyimperishabilityadenohypophysischemoautotrophynonspecificallycontemplativelyemployabilitiescomplementarity
...View all with 15 letters...
Phrases (288)
class pelecypodaalimentary pastemrs. humphrey wardprivate propertyfamily leporidaeorycteropus aferstonecrop familyspiny-headed wormfamily lophiidaepipeline company
...View all with 15 letters...
Words (176)
pheochromocytomatriphenylmethaneunpredictabilityhyperventilationphylogeneticallyelectromyographypharmaceuticallysphygmomanometerextemporaneouslyunapologeticallythrombocytopeniaunprofessionallyneuropsychiatrichypersalivationsheterokontophytahymenophyllaceaeparaformaldehydeextracorporeallyparamagneticallymicrogametophytehypersexualitiespolyphyleticallythermoplasticityhyperstimulatinghyperstimulationantiunemploymentparapsychologiesparasympatheticsapocryphalnesseshyperventilatinghypervitaminosesmalayo-polynesiansphygmomanometryglossopharyngealhemoglobinopathy
...View all with 16 letters...
Phrases (294)
tympanic membranestrictly speakingfamily cyperaceaefamily cyprinidaegenus crotaphytushypophyseal stalkwoolly plant louseautogenic therapyvolleyball playerexemplary damages
...View all with 16 letters...
Words (125)
parathyroidectomycardiorespiratorycontemporaneouslypsychotherapeuticinterdisciplinaryhyperreactivitiesphysiotherapeuticcercidiphyllaceaepolymorphonuclearparaformaldehydeskaleidoscopicallyhyperstimulationsspectroscopicallyhyperventilationsnonprofessionallysphygmomanometershypnotizabilitiesthrombocytopeniaspaternalisticallymammothermographypathophysiologieshyposensitizationmorphogeneticallycryopreservationslexicographicallycryptocrystallinelaryngopharyngealencephalomyelitiscrystallographerspentylenetetrazolcrystallographiespostrevolutionarymicropaleontologydisrespectabilitylymphadenopathies
...View all with 17 letters...
Phrases (340)
mary leontyne pricesalvia leucophyllahypoglycemic agentpearly everlastingclass rhodophyceaefamily dasypodidaelycopus americanusgenus symphalanguscapital of kentuckycylinder separator
...View all with 17 letters...
Words (54)
disproportionatelyhypercoagulabilityhyperaldosteronismneuropsychologicalpolyesterificationhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshyposensitizationspentylenetetrazolsanthropocentricitylipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallypteridospermaphytamucopolysaccharidehypercholesteremiamyeloproliferativephenomenologicallypheochromocytomatagranulocytopoiesesspectrographicallygranulocytopoiesisrepresentationallyneuropsychiatristselectromyographiesmetallographicallyelectrooculographymethylnaphthaleneselectrophotographypachycephalosaurusdephosphorylations
...View all with 18 letters...
Phrases (304)
revolutionary groupfamily physeteridaeeriobotrya japonicafreudian psychologyposterior pituitaryread-only memory chipmetric capacity unitfamily asparagaceaeantipsychotic agentmegacycle per second
...View all with 18 letters...
Words (40)
hyperparathyroidismcinematographicallypolyesterificationshypersensitizationsparathyroidectomieshypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesconceptualisticallycytopathogenicitiesbacteriochlorophyllphenomenalisticallyphenylthiocarbamideechoencephalographyphosphatidylcholinephosphoenolpyruvateinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallyanthropocentricallyelectroretinographyencephalomyelitidesphenylpropanolamineparasympathomimeticoverproportionatelyphytogeographicallyphytohemagglutininshyperconcentrationshypoadrenocorticismpsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilities
...View all with 19 letters...
Phrases (283)
water-plantain familyfamily cyclopteridaealpine type of glacierphytolacca americanafamily lepisosteidaefamily dasyproctidaegenus cryptobranchusgenus symphoricarposavogadro's hypothesisfamily tropaeolaceae
...View all with 19 letters...
Words (23)
hypercholesterolemiaparathyroidectomizedhyperadrenocorticismlymphogranulomatosesbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatouspsychopharmacologiesmicrophotometricallyhypercoagulabilitiesplethysmographicallyhyperparathyroidismsPhrases (227)
wyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaedevelopmental anatomydivision tracheophytafamily pseudococcidaeeucalyptus calophyllalophodytes cucullatusfriendly relationship
...View all with 20 letters...
Words (7)
hypogammaglobulinemiastereomicroscopicallyphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydehypercholesterolemiaspsychotherapeuticallyPhrases (185)
extrauterine pregnancyeucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaparty to the transactioncucurbita argyrospermaptolemy ii philadelphusspectroscopic analysisprocaine hydrochloridefamily myrmecophagidae
...View all with 21 letters...
Words (7)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydeselectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninePhrases (142)
haliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphateathyrium thelypteroidesmale reproductive systemparaguayan monetary unitatmospheric electricitysphyrapicus varius ruber
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (109)
posterior pituitary glandyellowstone national parkparis-sorbonne universityeuropean recovery programdorothy rothschild parkergroup pteridospermaphytasciadopitys verticillatatricyclic antidepressanteastern malayo-polynesianchrysanthemum parthenium
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (76)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprivately held corporationprimary sex characteristicapocynum androsaemifoliumexistentialist philosophyfederal republic of germanyhypersensitivity reactionchrysosplenium americanum
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (52)
myroxylon balsamum pereiraepolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinlepidocybium flavobrunneumhormone-replacement therapypodkamennaya tunguska riveraleksey maksimovich peshkov
...View all with 25 letters...
Phrases (52)
employee stock ownership plansubdivision coniferophytinabureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmusnonthrombocytopenic purpurasuperorder labyrinthodontia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (36)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanadeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (27)
revolutionary people's struggleephippiorhynchus senegalensiscardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitydissident irish republican armyface-amount certificate companyrevolutionary proletarian armysmall computer system interfaceimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (19)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity tester
...View all with 29 letters...
Phrases (22)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborn
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (10)
great smoky mountains national park2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightfibrocystic disease of the pancreasmarine corps intelligence activityovulation method of family planningfrequency-response characteristicPhrases (9)
weakly interacting massive particlecercopithecus aethiops pygerythrusprimary subtractive colour for lightoculopharyngeal muscular dystrophyprogressive emphysematous necrosischrysanthemum coronarium spatiosumadult respiratory distress syndromecystic fibrosis transport regulatorjohn f. kennedy international airportPhrases (12)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economypositron emission tomography scannersubacute inclusion body encephalitis
...View all with 33 letters...
Phrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdefense advanced research projects agencysixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn
