Words Containing: Y,I,N
(In Any Order)
There are 12,036 words,
6,338 phrases and
0 abbr's with
Y,I,N in.
Best Scoring Words With: Y,I,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zinkify | 7 | 26 | ||||||
Valid word for Scrabble US
| ||||||||
| chintzy | 7 | 24 | adjectiveadj | |||||
adjective satellite • of very poor quality; flimsy • embarrassingly stingy | ||||||||
| zincify | 7 | 24 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| zincky | 6 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| cozying | 7 | 22 | verb, adjectivev, adj | |||||
noun • a padded cloth covering to keep a teapot warm adjective satellite • enjoying or affording comforting warmth and shelter especially in a small space • having or fostering a warm or friendly and informal atmosphere • suggesting connivance | ||||||||
| jimminy | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| nazify | 6 | 21 | verbv | |||||
verb • cause or force to adopt Nazism or a Nazi character | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yinWords (537)
playingfinallystayingdestinyyellinganytimedignitytiffanyanxietylindsaydenyinginquirycynthiachimneycynicalburyingdynamictrinitywhitneyhygienecopyingsyringesnidelyalimonyblindlyyappingdensityrelyingcyclingwyomingenquirynightlycyanideplainlyyawning
...View all with 7 letters...
Phrases (18)
in stylebuy intotying upsun citydry kilndry pinttai yuandry unitmay winemaya lin
...View all with 7 letters...
Words (952)
anythingstudyingcarryingordinaryfriendlyindustryidentityentirelymarryinghumanityannoyingidentifyworryingministryeternityanalysisegyptianunlikelydynamiteinsanitypartyingsilentlyapplyingintimacyminorityinfantryquantitybullyingbrittanyimmunityinfinityvineyardimplyingvicinityhypnosis
...View all with 8 letters...
Phrases (47)
minor keysign awaydrying upiron ladyrainy dayeye blinkbig moneyin the wayin theorypond lily
...View all with 8 letters...
Words (1423)
boyfriendcertainlycommunitytestimonyinstantlyvirginitysincerelyimaginaryintegritycertaintyphysicianmachineryinitiallyinventoryevidentlynecessityintensityinfirmarysincerityamazinglywillinglymentalitygenuinelyseeminglysyntheticmaternityviolentlyrecyclinganalyzingmatrimonysyndicatewhinnyingpatientlyintenselyinability
...View all with 9 letters...
Phrases (96)
in a bad waymanila bayby machinehyoid boneappian wayman fridayground ivygin rickeyfamily manegg laying
...View all with 9 letters...
Words (1715)
everythingdefinitelyuniversityincrediblyoriginallyconspiracyterrifyingdictionarygenerosityfraternitymissionarydisneylandmayonnaiseefficiencyeyewitnesspresidencysatisfyinggymnasticshorrifyinginevitablyhypnotizedcontinuityironicallyinsecurityinfidelitytestifyingunderlyingunbirthdayinfinitelydeficiencyinternallyveterinarydistinctlyintimatelyordinarily
...View all with 10 letters...
Phrases (165)
hindu deityepoxy resinenergy unitline of dutyfamily linemt. mckinleyfield pansyaniline dyeyemeni rialcanary bird
...View all with 10 letters...
Words (1763)
opportunityanniversarypersonalitydifferentlynecessarilytechnicallyimportantlyessentiallycountrysideemotionallypreliminarypotentiallyvoluntarilysensitivitygeneticallyfinanciallyaccordinglybabysittinguncertaintycontinuallynationalitydaydreamingsovereigntyidentifyingmomentarilybeneficiaryreactionarytranquilityconsciouslybrilliantlyconsistencyinvoluntaryinstabilitycontingencymonstrosity
...View all with 11 letters...
Phrases (261)
genus myxinelaying claimin a broad waylaying wasteelinor wyliebulb syringesonny listonbryonia albaspiny puffersensory hair
...View all with 11 letters...
Words (1562)
accidentallyoccasionallychristianityincreasinglysurprisinglyindistinctlypennsylvaniacontinuouslyincidentallyunbelievablyevolutionaryindefinitelydisciplinarypassionatelysufficientlypenitentiaryaccompanyingindividuallymunicipalityconsiderablygynecologistencyclopediaconsistentlysynchronizedeconomicallyinvisibilitydefinitivelyauthenticityconvenientlyunofficiallyromanticallystorytellingconstituencytranquillityhorizontally
...View all with 12 letters...
Phrases (377)
staying powerbody stockinggenus glycinescantily cladread-only filehockey clinicshaking palsymount whitneychinese deityphantasy life
...View all with 12 letters...
Words (1344)
extraordinaryrevolutionaryunnecessarilyintentionallyexceptionallysignificantlyindependentlyinstinctivelytraditionallydysfunctionalvulnerabilityunconsciouslycontradictoryinterestinglyindividualitycomplimentaryparliamentaryinadvertentlyfantasticallysubstantiallygynaecologistprecautionarypredominantlyhypochondriacexponentiallyinvoluntarilyintelligentlyfrighteninglymagnificentlyastonishinglyalternativelynitroglycerineverlastinglyconsecutivelypainstakingly
...View all with 13 letters...
Phrases (433)
harvey cushingel iskandriyahvaginal arterydirect antonymauditory sensein a similar waymount mckinleyinventory itembrandy snifterspiny anteater
...View all with 13 letters...
Words (976)
responsibilitysimultaneouslyprofessionallyscientificallycinematographypsychoanalysisintellectuallycoincidentallyaffectionatelyelectronicallysubconsciouslyaccountabilityoverwhelminglysentimentalityhypersensitivesustainabilityunquestionablyintentionalitycytogeneticistinterplanetaryphotosynthesisunsatisfactoryconfidentiallythermodynamicshyperventilateproportionallynitroglycerineexcruciatinglyintermittentlyconservativelypsychoanalyticdiscriminatoryconventionallychemosynthesispsychoneurotic
...View all with 14 letters...
Phrases (486)
field intensitymoonseed familywilliam tyndaledimethyl ketonepituitary glandtrionyx muticushigh technologyveliky novgorodyellowish brownigor stravinsky
...View all with 14 letters...
Words (717)
confidentialityextraordinarilyinternationallyunconditionallytechnologicallyunintentionallyinstantaneouslysynchronizationenvironmentallyinappropriatelyanaesthesiologyconscientiouslychronologicallysynergisticallyinaccessibilityincompatibilitycrystallizationoversimplifyingintellectualityparentheticallyplenipotentiarycondescendinglysuppositionallyaerodynamicallyproportionatelymaneuverabilitycardiopulmonarysynchronisationdisappointinglyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallyinconspicuouslysuccinylcholine
...View all with 15 letters...
Phrases (565)
syringa vulgarisby fits and startsstay of executionbenefit of clergyalimentary pasteasamiya languagehelen wills moodydialysis machinefamily tinamidaeannunciation day
...View all with 15 letters...
Words (289)
enthusiasticallyindiscriminatelyirresponsibilityconstitutionallyincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationpsychoanalyticalquintessentiallyphylogeneticallyuncompromisinglyjournalisticallynonrevolutionarycircumstantiallymonosyllabicallyunapologeticallyincontrovertiblythrombocytopeniahypersensitivityunprofessionallyinconceivabilityconversationallyincorruptibilityneuropsychiatricdiscriminatorilyhypersalivationsinextinguishablypornographicallyjurisdictionallyantistrophicallyspondylarthritisparamagneticallytrinitroglycerin
...View all with 16 letters...
Phrases (555)
hypodermic needletympanic membranein a beastly manneritalian greyhoundstrictly speakingchristian huygensfamily cyprinidaecapital of hungarydefinite quantityin all probability
...View all with 16 letters...
Words (175)
counterinsurgencyunconventionalitysuperconductivityconstitutionalityanthropologicallyneurophysiologistthermodynamicallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsycholinguisticsmultidisciplinaryinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallyunexchangeabilityspondylolisthesisradioimmunoassayshyperstimulationshyperventilationsnonprofessionallymonochromaticallyrationalisticallyhypnotizabilitiesthrombocytopeniashypochondriacallychlortetracyclinemonosyllabicitiespaternalisticallyhyposensitizationarchitectonicallyferrimagneticallymorphogenetically
...View all with 17 letters...
Phrases (560)
mary leontyne pricedivision bryophytabalaena mysticetusczech monetary unitproteolytic enzymelycopodium alpinumhypoglycemic agentcuban monetary unitinterstate highwaypearly everlasting
...View all with 17 letters...
Words (90)
disproportionatelyinconsequentialityhyperaldosteronisminterchangeabilityneuropsychologicalhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationpolyribonucleotidemultifunctionalitynoncomprehensivelysphygmomanometrieshypophysectomizinghyposensitizationsanthropocentricitycylindrical-stemmedlaryngopharyngitispostpsychoanalytictriphosphopyridineunconstitutionallylymphangiographieshyperbilirubinemiaimmunocytochemicaltransformationallydiethylmalonylurearecrystallizationsdistinguishabilitycounterintuitivelymagnetostrictivelyphenomenologicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinates
...View all with 18 letters...
Phrases (529)
bombycilla cedrorunworldly possessionsrevolutionary groupadministrative bodydivision anthophytadame sybil thorndikeeriobotrya japonicalachrymal secretiondivision cynodontiafreudian psychology
...View all with 18 letters...
Words (61)
cinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesotorhinolaryngologyhypolipoproteinemiaparthenogeneticallycrosslinguisticallynonrelativisticallyunconstitutionalitycytodifferentiationconceptualisticallycytopathogenicitiesimmunocytochemistryindividualisticallymagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramcross-linguisticallythree-dimensionalityimpressionistically
...View all with 19 letters...
Phrases (497)
building supply housewater-plantain familyscandinavian countryjohn millington syngefamily cynoglossidaeitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glaciergiles lytton strachey
...View all with 19 letters...
Words (36)
counterrevolutionaryuncharacteristicallyoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveradioimmunoassayablelipochondrodystrophyhyperadrenocorticismindistinguishabilitycytodifferentiationsimmunocytochemicallylymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiamagnetohydrodynamicshistoincompatibilityiodochlorhydroxyquindeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditisphotophosphorylationsyncategorematicallyhyperconsciousnessesdimethylnitrosamines
...View all with 20 letters...
Phrases (395)
william stanley jevonshonduran monetary unitmalawian monetary unitlebanese monetary unitoryctolagus cuniculusmarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysisbyelorussian language
...View all with 20 letters...
Words (12)
hypogammaglobulinemiaotorhinolaryngologistimmunocytochemistriesacetylcholinesterasesotorhinolaryngologiesdendrochronologicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyclinicopathologicallytetrahydrocannabinolsPhrases (289)
icelandic monetary unitelectrolytic condensernikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unitbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unit
...View all with 21 letters...
Words (6)
intercomprehensibilityotorhinolaryngologicalotorhinolaryngologistshexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (254)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (185)
family threskiornithidaeposterior pituitary glandmeperidine hydrochlorideyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusparis-sorbonne universityinterlocutory injunctionkyrgyzstani monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitishyperbetalipoproteinemiaphosphatidylethanolaminePhrases (138)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromesir terence mervyn rattigandistinguished flying cross
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (102)
myroxylon balsamum pereiraeigor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline system
...View all with 25 letters...
Phrases (77)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrand
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (59)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (51)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (32)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (31)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (19)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (21)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovnonsteroidal anti-inflammatory druguniversity of california at berkeleytheory of electrolytic dissociationlymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (18)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratory
...View all with 37 letters...
