Words Containing: Y,I,H
(In Any Order)
There are 7,019 words,
3,568 phrases and
1 abbr with
Y,I,H in.
Best Scoring Words With: Y,I,H
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| whizzy | 6 | 33 | adjectiveadj | |||||
adjective • Nifty; impressive, often in a superficial or showy way. | ||||||||
| schizzy | 7 | 33 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hypoxic | 7 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chintzy | 7 | 24 | adjectiveadj | |||||
adjective satellite • of very poor quality; flimsy • embarrassingly stingy | ||||||||
| schizy | 6 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| squishy | 7 | 22 | adjectiveadj | |||||
adjective satellite • easily squashed; resembling a sponge in having soft porous texture and compressibility | ||||||||
| hypoxia | 7 | 22 | nounn | |||||
noun • oxygen deficiency causing a very strong drive to correct the deficiency | ||||||||
| zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| oxyphil | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (247)
historyholidaythirstyhighwaycharityhappilyheavilywhiskeyphysicspsychiclightlytimothytightlycynthiachimneystylishwhitneyhygienehillaryrightlyyiddishchristynightlyhaywiresquishythirdlytyphoidhayridehickoryhastilythyroidrhymingthriftychicoryfishery
...View all with 7 letters...
Phrases (12)
the cityfly highholy oilh. pylorihair dyemay fishhenry iihenry ivtoy withhenry vi
...View all with 7 letters...
Words (429)
anythingbirthdayphysicalhumanityslightlyalmightydaylighthorriblyeyesightsyphilishypnosishumilityhysteriahumidityhurryingbrightlychastitymythicalhypnoticrhythmicskylightepiphanyladyshipshipyardphysiqueladyfishchivalryhygienicheartilyhideawaycrayfishhystericlynchingdimethylsisyphus
...View all with 8 letters...
Phrases (28)
by rightsin the wayin theorymilk wheyhive awaybody hairby choicelindy hopby inchesholy writ
...View all with 8 letters...
Words (733)
authoritychemistrypsychoticphysicianmachineryhypocritesynthetichairstylejellyfishphysicistbiographyhypocrisywhinnyinghimalayaspsychosishostilitycopyrighthierarchylabyrinthhillbillyhemingwayyorkshirehydraulichypnotizedaylightshydroxidefoolishlyunhappilyhydrazineplaythinghurriedlyhypnotisthystericssynthesischlamydia
...View all with 9 letters...
Phrases (48)
by machinehigh stylehyoid boneitchy feetii timothyright awayhair dryerbenny hillhair stylewhile away
...View all with 9 letters...
Words (895)
everythingphilosophyphysicallyhystericalhypothesishorrifyinghypnotizedhereditarysympathizepsychiatryfaithfullyunbirthdayrightfullyhydraulicsphysiologyinherentlychemicallystealthilyplaywrightdishonestyshockinglyhieronymuspolyphonicstrychninearrhythmianeighborlyscathinglysympathiseprehistoryinhumanitycharminglyheroicallyhabituallyhydroponicpatriarchy
...View all with 10 letters...
Phrases (82)
hindu deityby the piecebody weightchalcid flytight moneyspanish flyhanging flythird partyray of lightbasil thyme
...View all with 10 letters...
Words (974)
technicallypsychiatrichospitalitysympatheticheavyweightcalligraphyhypothermiapsychedelicdehydrationtchaikovskysynchronizesynthesizerhyperactiveichthyologyfrightfullypolytechnicmetaphysicsfashionablyiconographybaryshnikovchronicallyhypospadiashydroponicssynesthesiatachycardiasynthesizedcopyrightedasphyxiatedsympathizerhypnotizinghypothermichairstylistpolymorphicsphericallyphysicality
...View all with 11 letters...
Phrases (132)
high qualitymighty mousesensory hairfilthy lucrebilly grahambilly the kidheavy hitteralkyl halidehydrogen iontightly knit
...View all with 11 letters...
Words (967)
psychiatristpsychologistchristianityhypocriticalstraightawaysynchronizedhypotheticalhistoricallyauthenticitybloodthirstymetaphysicalmythologicalpsychopathichystericallyhorizontallyasphyxiationbiochemistrytechnicalitybiosynthesisnymphomaniacdelightfullypatheticallyhypertensionanaphylacticrhythmicallymechanicallyposthypnoticperipherallyhieroglyphicincoherentlytriumphantlyrefreshinglytheophyllineastrophysicshypochlorite
...View all with 12 letters...
Phrases (162)
woody guthriemolly pitcherhockey clinicshaking palsymount whitneyathletic typechinese deityphantasy lifechristmas daydwight l. moody
...View all with 12 letters...
Words (779)
psychologicaltheoreticallyhomosexualityautobiographyhieroglyphicsphysiologicalpsychosomatichypochondriacphysiotherapyfrighteninglyastonishinglyhyperhidrosisbiotechnologyhyperactivityunsympatheticaestheticallyhypoglycaemiccholecystitisthyroidectomyneurosyphilishydroelectrichybridizationhallucinatoryhydrochloridesynchronicityantipsychotichydraulicallyunflinchinglytheatricalityhypercalcemiasynchronisinghumiliatinglystaphylococcihyperglycemicichthyologist
...View all with 13 letters...
Phrases (190)
harvey cushingel iskandriyahbitter hickoryhydrated oxidecardiac rhythmhigh-and-mightyproperty rightbilly mitchelldata hierarchyheavy particle
...View all with 13 letters...
Words (685)
hypotheticallycinematographypsychoanalysismetaphoricallyoverwhelminglymathematicallygeographicallyhypersensitivealphabeticallycardiomyopathyphotosynthesisastrophysicistpathologicallythermodynamicshyperventilatepsychoanalyticchemosynthesispsychoneuroticmetaphysicallymetempsychosistelepathicallynephrotoxicityscholasticallynarcosynthesismicrochemistrypsychodynamicsunsynchronizedinheritabilityhypothyroidismhydropneumaticpyelonephritisorthopedicallyarchetypicallyunthinkabilitydemythologised
...View all with 14 letters...
Phrases (229)
thoracic cavitydimethyl ketonemyrrhis odoratahigh technologyyellowish brownbusman's holidaysymphonic musicprimary feathertypha latifoliablended whiskey
...View all with 14 letters...
Words (518)
psychologicallypsychotherapisttechnologicallysynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitychronologicallysympathomimeticparentheticallypsychobiologisttherapeuticallysynchronisationsuccinylcholineneurophysiologymethylphenidatestereochemistryphotosynthesizelogarithmicallyauthoritativelyhypochondriacalgynandromorphicsympatheticallyarchitecturallydemographicallyheartbreakinglyeuphemisticallyneuropsychiatrypsychiatricallycomprehensivelydiphenhydramineimperishabilitykinesthetically
...View all with 15 letters...
Phrases (306)
helen wills moodydialysis machinesystem of weightsjohn quincy adamspsychotic beliefsodium hydroxidehyoscyamus nigerspiny-headed wormfamily lophiidaenational holiday
...View all with 15 letters...
Words (246)
enthusiasticallyhemorrhoidectomyincomprehensiblycatastrophicallytriphenylmethanehyperintelligenthyperventilationpsychoanalyticalphylogeneticallypsychophysiologypharmaceuticallyerythroblastosisthermostaticallypsychobiologicalthrombocytopeniaelectrochemistryhypersensitivityphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablypornographicallythermometricallyantistrophicallyspondylarthritisradiographicallyhypersensitizingmicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulating
...View all with 16 letters...
Phrases (298)
hypodermic needleitalian greyhoundchristian huygenscapital of hungarywilliam wycherleychemical analysisalan lloyd hodgkindwight lyman moodynevil shute norwayautogenic therapy
...View all with 16 letters...
Words (151)
straightforwardlyanthropologicallyparathyroidectomyneurophysiologistthermodynamicallyphilanthropicallypsycholinguisticspsychotherapeutichyperreactivitiesphysiotherapeuticcercidiphyllaceaeunexchangeabilitythermoperiodicityspondylolisthesishyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitiesthrombocytopeniashypochondriacallychlortetracyclinehypophysectomizespathophysiologieshyposensitizationhypophysectomisedarchitectonicallymorphogeneticallyhypophysectomizedlexicographicallyencephalomyelitiscrystallographieslymphadenopathieshyperalimentationlymphangiographic
...View all with 17 letters...
Phrases (321)
division bryophytasalvia leucophyllaczech monetary unithypoglycemic agentinterstate highwaysubphylum craniatatheological systemotto fritz meyerhofantipsychotic drugprimary censorship
...View all with 17 letters...
Words (97)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalhypersensitivenesshypersensitivitieshypersensitizationspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometrieshypoparathyroidismhypophysectomizingpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitislipopolysaccharidepostpsychoanalytictriphosphopyridinelymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadiethylstilbestroldistinguishabilitymucopolysaccharidehypercholesteremiaphenomenologically
...View all with 18 letters...
Phrases (300)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyafghan monetary unitclass schizomycetesread-only memory chipfamily trichechidaeantipsychotic agent
...View all with 18 letters...
Words (71)
hyperparathyroidismhydrochlorothiazidepsychophysiologicalcinematographicallyhypersensitizationsotorhinolaryngologyhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologist
...View all with 19 letters...
Phrases (305)
building supply housejohn millington syngehydrastis canadensisgiles lytton stracheyphytolacca americanadivision schizophytagenus symphoricarposavogadro's hypothesiscalycanthus floridusathyrium filix-femina
...View all with 19 letters...
Words (46)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveparathyroidectomizedlipochondrodystrophycrystallographicallyhyperadrenocorticismindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityiodochlorhydroxyquinelectrophysiologicalelectrophysiologistsimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazides
...View all with 20 letters...
Phrases (264)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysisclyde william tombaugh
...View all with 20 letters...
Words (19)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologisthypersusceptibilitiesimmunocytochemistriesmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (198)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphus
...View all with 21 letters...
Words (9)
spectrophotometricallyintercomprehensibilityotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (166)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (123)
family threskiornithidaemeperidine hydrochloridekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridan
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (93)
argyroxiphium sandwicensedivision heterokontophytaprivately held corporationprimary sex characteristicdistinguished flying crossantiarrhythmic medicationfluoxetine hydrocholorideexistentialist philosophytechnology administrationhypersensitivity reaction
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (69)
igor fyodorovich stravinskysymphoricarpos orbiculatusmodest petrovich mussorgskyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddington
...View all with 25 letters...
Phrases (57)
hunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (42)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (32)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican army
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristic
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (17)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornhenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trends
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (11)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningvladimir vladimirovich mayakovskihuygens' principle of superpositionnorth atlantic treaty organizationfrequency-response characteristic
...View all with 31 letters...
Phrases (16)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn
