Words Containing: Y,I,C,S
(In Any Order)
There are 4,719 words,
2,964 phrases and
0 abbr's with
Y,I,C,S in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
schizzy | 7 | 33 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
schizy | 6 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
psychic | 7 | 19 | nounn | |||||
noun • a person apparently sensitive to things beyond the natural range of perception adjective satellite • affecting or influenced by the human mind • outside the sphere of physical science | ||||||||
kitschy | 7 | 19 | adjectiveadj | |||||
adjective satellite • effusively or insincerely emotional | ||||||||
hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
chymics | 7 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
shticky | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
sickbay | 7 | 18 | noun, adjectiven, adj | |||||
noun • (nautical) a room for the treatment of the sick or injured (as on a ship) | ||||||||
pyknics | 7 | 18 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
mickeys | 7 | 18 | nounn | |||||
noun • (ethnic slur) offensive term for a person of Irish descent | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (93)
societyphysicspsychicchristyspecifycyclistscarifykitschysickbaymycosiscopyiststypticscythiascarilycrisplysaucilysnitchytricksyecdysisslicklyclerisyscrimpyspicerypiscarysylphiccosyingscryingglycinsclayishchymistcushilycysteinscorifycyclinscitrusy
...View all with 7 letters...
Phrases (5)
sun cityst. cyrilsick paycyrus iistick byWords (216)
securityphysicalstrictlyolympicssymbolicmysticalsociallychastitydynamicssanctitycynicismscrutinyclassifyscarcitydyslexicsystemicjoystickcrayfishhystericsynapticmiscarrylyricistsacristysanctifycryonicsclumsilycystitissystolicpsychingdystonicscythiancousinlysynopticfiscallydynastic
...View all with 8 letters...
Phrases (3)
by inchesbasic dyecity deskWords (392)
basicallypreciselydiscoverychemistrycuriosityspeciallyspecialtysincerelypsychoticphysiciannecessitysinceritysyntheticphysicisthypocrisysyndicatepsychosisresidencysociologymusicallyobscenityobscuritycuriouslyhystericsmysticismviciouslysymbioticobstinacyscurryingsymphoniccausalitychrysalisgymnasticcharybdisyardstick
...View all with 9 letters...
Phrases (12)
cosmic rayin any casemason citypilar cysttipsy cakecandy kisssioux citycoast lilyphysic nuteasy chair
...View all with 9 letters...
Words (513)
especiallyphysicallyconspiracyhystericalpresidencygymnasticssimplicityspecialityinsecuritypsychiatrydiscreetlydistinctlysystematichydraulicsgraciouslysurgicallyshockinglycautiouslycosmicallycommissaryinsurgencystrychninesyndicatedscathinglyelasticitydiscretelysuccinctlydecisivelyinsolvencyecchymosisspecifyingasymmetricmusicalitychildishlysyphilitic
...View all with 10 letters...
Phrases (28)
bing crosbycity limitsplay trickscrown daisysilver cityhoney crispchinese yamchalcis flyivory coastjersey city
...View all with 10 letters...
Words (636)
necessarilycountrysidepsychiatricsympatheticexclusivelyconsciouslyconsistencysymmetricalmercilesslydrasticallyexcessivelyaristocracypsychedelicmasculinitytchaikovskycataclysmicdysfunctionpromiscuitysynchronizeincessantlydiscrepancyvicariouslymetaphysicspyroclasticcrystallineselectivelyferociouslyclassicallysymptomaticexclusivityscientologydeliciouslysystematicshydroponicsmaliciously
...View all with 11 letters...
Phrases (67)
special jurybicycle seatmystic jewelclosely knitdirty tricksvena cysticacypress vinecelery stickdisplay caseopen society
...View all with 11 letters...
Words (694)
psychiatristspecificallyoccasionallypsychologistchristianityincreasinglyindistinctlycontinuouslydisciplinarysufficientlysatisfactoryconsiderablygynecologistmiraculouslyconsistentlysynchronizedhistoricallyridiculouslymetaphysicalconstituencypsychopathichystericallysuspiciouslybiochemistrymeticulouslyaerodynamicssymbolicallyartisticallyconclusivelycrystallizedasymmetricalrespectivelyposthypnoticsubjectivitydomestically
...View all with 12 letters...
Phrases (97)
body stockinggenus glycinevisual acuityscantily cladlickety splitchinese deitychristmas dayascension dayacrylic resincost analysis
...View all with 12 letters...
Words (704)
psychologicalunnecessarilysignificantlyinstinctivelystatisticallydysfunctionalunconsciouslyfantasticallyhieroglyphicsphysiologicalpsychosomaticgynaecologistrealisticallystrategicallysarcasticallystereotypicalconsecutivelysuperficiallydiscretionaryunsympatheticaestheticallyinconsistencyconspicuouslyidiosyncraticcholecystitisinsufficiencysymmetricallyaccessibilitysynchronicityantipsychoticmystificationsynchronisingpicturesquelystaphylococcidistinctively
...View all with 13 letters...
Phrases (149)
harvey cushingaleatory musiccooley's anemiaacrylate resincost of qualitycanary islandsgenus acinonyxgenus cyprinusscoring systemgenus dactylis
...View all with 13 letters...
Words (575)
scientificallypsychoanalysissystematicallysubconsciouslyrespectabilitycytogeneticistastrophysicistunsatisfactorythermodynamicsconservativelypsychoanalyticdiscriminatorychemosynthesispsychoneuroticsusceptibilitysatisfactorilylinguisticallymetaphysicallymetempsychosissociologicallyscholasticallydiscourteouslynarcosynthesismicrochemistrypsychodynamicsinsufficientlyconstructivelyoptimisticallyastronomicallyunsynchronizedsuperficialityinconsiderablysimplisticallyidealisticallyaltruistically
...View all with 14 letters...
Phrases (202)
order mysidaceatrionyx muticussabbatical yearcarya laciniosacooley's anaemiasymphonic musicabstract entitychinese parsleyclassical stylemost especially
...View all with 14 letters...
Words (418)
psychologicallypsychotherapistsynchronizationphysiologicallydisrespectfullyphilosophicallyconscientiouslysympathomimeticsynergisticallyinaccessibilitycrystallizationpsychobiologistcondescendinglymicroscopicallysynchronisationcontroversiallyinconspicuouslysuccinylcholinecytomegaloviruscompassionatelystereochemistryrecrystallizinglackadaisicallyintrospectivelygastronomicallyseismologicallysympatheticallycorrespondinglyretrospectivelyunceremoniouslyinconsideratelyeuphemisticallyritualisticallyneuropsychiatrypessimistically
...View all with 15 letters...
Phrases (225)
auditory ossiclestay of executiondialysis machineadvisory servicejohn quincy adamspsychotic beliefgenus bombycillahyoscyamus nigerstonecrop familyfamily astacidae
...View all with 15 letters...
Words (182)
enthusiasticallyindiscriminatelyconstitutionallyincomprehensiblycatastrophicallypsychoanalyticaluncompromisinglypsychophysiologyjournalisticallycircumstantiallymonosyllabicallythermostaticallysurrealisticallypsychobiologicalelectrochemistryparapsychologistconversationallyneuropsychiatricdiscriminatorilyjurisdictionallyantistrophicallycommensurabilitythermoplasticityparaphrasticallyparapsychologiespolysynapticallycommonsensicallypositivisticallyhypersusceptibleparasympatheticshyperviscositieshypocoristicallymonopolisticallynonpsychiatristsindiscernibility
...View all with 16 letters...
Phrases (257)
strictly speakingchristian huygenscardiac glycosidecygnus buccinatorchemical analysisamerican sycamorepodocarpus familyfamily locustidaecarya illinoensiscarya illinoinsis
...View all with 16 letters...
Words (105)
counterinsurgencysuperconductivityconstitutionalitymaterialisticallycardiorespiratoryelectrostaticallyinconsequentiallysocioeconomicallypsycholinguisticspsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeutickaleidoscopicallyradioisotopicallyparapsychologistsparasitologicallyspectroscopicallyrationalisticallythrombocytopeniasmonosyllabicitiespaternalisticallyhypophysectomizeshypophysectomisedhypophysectomizedcryopreservationscryptocrystallineidiosyncraticallyencephalomyelitiscrystallographiesillusionistically
...View all with 17 letters...
Phrases (269)
salvia leucophyllabalaena mysticetuslycopus americanussubphylum craniatatheological systemantipsychotic drugcylinder separatorprimary censorshipcaesarian deliverycalycanthus family
...View all with 17 letters...
Words (69)
characteristicallyinconsequentialitypsychopathologicalsociopsychologicalneuropsychologicalpolyesterificationcoccidioidomycosisspectroheliographynoncomprehensivelypsychotherapeuticshypophysectomizingpathophysiologicalcylindrical-stemmedlipopolysaccharidepostpsychoanalyticunconstitutionallystereospecificallystoichiometricallyrecrystallizationsmucopolysaccharidehypercholesteremiamagnetostrictivelysubmicroscopicallydehydrochlorinasesdehydrochlorinatesglycosaminoglycanstrichloroethylenesorthopsychiatristsoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesisaerothermodynamicsneuropsychiatristselectromyographies
...View all with 18 letters...
Phrases (277)
bombycilla garruluslachrymal secretiondivision cynodontiafreudian psychologypodilymbus podicepscolumbia universityclass schizomyceteskilocycle per secondsuperiority complexfamily asparagaceae
...View all with 18 letters...
Words (42)
psychophysiologicalpolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomiescrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallycytopathogenicitiesimmunocytochemistryindividualisticallyphenomenalisticallyphosphatidylcholinechromoblastomycosiscontradistinctivelycross-linguisticallyimpressionisticallyelectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshistopathologicallyhistoriographicallydihydrostreptomycinparasympathomimeticpsychopharmacologicsymptomatologicallydiethylcarbamazinessociolinguisticallyhyperconcentrationspsychophysiologists
...View all with 19 letters...
Phrases (249)
acetylsalicylic acidscandinavian countryfamily cynoglossidaehydrastis canadensisgiles lytton stracheyfamily dasyproctidaedivision schizophytagenus symphoricarposcapital of kyrgyzstancalycanthus floridus
...View all with 19 letters...
Words (36)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallylipochondrodystrophycrystallographicallyhyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditishydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercholesterolemichypercoagulabilitieshyperconsciousnessesheterobasidiomycetesplethysmographically
...View all with 20 letters...
Phrases (227)
yellow-shafted flickerwyethia amplexicaulisorder mycelia steriliaorder myxobacterialesoryctolagus cuniculusdivision tracheophytabalance sheet analysisdianthus caryophyllusmechanically skillfulsuricata tetradactyla
...View all with 20 letters...
Words (11)
psychopharmacologicalhypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesmucopolysaccharidosisacetylcholinesteraseshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (169)
electrolytic condenserigor ivanovich sikorskyhelichrysum bracteatumdesoxyribonucleic acideucalyptus fraxinoidescynoglossum officinalecapital of pennsylvaniaginglymostoma cirratumparty to the transactioncucurbita argyrosperma
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (160)
lycopersicon esculentumhaliaeetus leucorhyphusloyalist volunteer forcesubfamily bassariscidaerhythm and blues musiciancrescent city connectionmale reproductive systemfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruber
...View all with 22 letters...
Words (2)
laryngotracheobronchitisschizosaccharomycetaceaePhrases (92)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying crossapocynum androsaemifoliumtechnology administration
...View all with 24 letters...
Phrases (72)
igor fyodorovich stravinskyfrancis scott key fitzgeraldsymphoricarpos orbiculatusmodest petrovich mussorgskypolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidesmichelson-morley experimentandrei arsenevich tarkovskyconstant of proportionality
...View all with 25 letters...
Phrases (53)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision basidiomycotinasubdivision coniferophytinasubdivision deuteromycotina
...View all with 26 letters...
Phrases (43)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkincommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (40)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Phrases (23)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemhydrangea macrophylla hortensisultrasonic pulse velocity testerfrancisco jose de goya y lucientes
...View all with 29 letters...
Phrases (24)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiency
...View all with 30 letters...
Phrases (12)
digital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityvladimir vladimirovich mayakovskihuygens' principle of superpositiondefense information systems agency
...View all with 31 letters...
Phrases (19)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (12)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacus
...View all with 33 letters...
Phrases (8)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratory
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay