Words Containing: Y,I,A
(In Any Order)
There are 13,221 words,
8,146 phrases and
2 abbr's with
Y,I,A in.
Best Scoring Words With: Y,I,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pizazzy | 7 | 39 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
quakily | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
qualify | 7 | 22 | verbv | |||||
verb • prove capable or fit; meet requirements • pronounce fit or able • make more specific • make fit or prepared • specify as a condition or requirement in a contract or agreement; make an express demand or provision in an agreement • describe or portray the character or the qualities or peculiarities of • add a modifier to a constituent | ||||||||
hypoxia | 7 | 22 | nounn | |||||
noun • oxygen deficiency causing a very strong drive to correct the deficiency | ||||||||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
hazily | 6 | 21 | adverb, adjectiveadv, adj | |||||
adverb • through a haze • in an indistinct way | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (543)
playingfinallystayingrealityholidayqualityabilityanytimelibraryhighwaytypicalcharityhappilyheavilyprivacyprimarygravitydisplaytiffanyanxietyrailwaysatisfypyramidvarietyrapidlylindsaydaytimecynthiaqualifycynicaldynamicclarifyclarityhillaryalimony
...View all with 7 letters...
Phrases (22)
sea lilypay dirtday lilydie awayabide bywild yamtai yuanhair dyebaby oilmay fish
...View all with 7 letters...
Words (1010)
anythingbirthdaymilitarycarryingordinaryphysicalmarryingactivityhumanityannoyingfacilityalmightyanalysisdaylightmajoritycapacityegyptiandynamiteinsanitysolitarypartyingmoralityapplyingintimacyliterarysidewaysdrivewayinfantryquantitymysticalbrittanymalaysiasociallyvineyardequality
...View all with 8 letters...
Phrases (61)
sign awaywipe awaypay claimiron ladyrainy dayin the wayditty baggive awayfile awayhive away
...View all with 8 letters...
Words (1423)
certainlybasicallyauthorityliterallyspeciallyinstantlyspecialtyimaginaryvirtuallycertaintyphysicianmachinerysexualityinitiallyartilleryyggdrasilillegallyprivatelytypicallyinfirmaryliabilityamazinglyformalitymentalitystabilitybrutalitymaternityhairstyleprimarilybiographypartiallyanalyzingmatrimonyfairytalesyndicate
...View all with 9 letters...
Phrases (129)
in a bad waymanila bayby machineappian wayloya jirgaman fridaylike crazygrey friarright awayhair dryer
...View all with 9 letters...
Words (1700)
especiallyofficiallyphysicallyoriginallyconspiracyultimatelyhystericalbabysitterrelativelydictionarycreativityfraternitysolidaritymissionarydisneylandmayonnaisepopularitydisabilitysatisfyinggymnasticstragicallyinevitablyyugoslaviaironicallyhereditaryspecialitysympathizecapabilitypsychiatryfaithfullyrelativityunbirthdayinternallysimilarityveterinary
...View all with 10 letters...
Phrases (213)
private eyefamily linefield pansymaxim gorkyrift valleyaniline dyekuwait cityyemeni rialparis daisyrailway car
...View all with 10 letters...
Words (1857)
immediatelyanniversarypersonalitypracticallynecessarilytechnicallyimportantlyessentiallybeautifullyemotionallypsychiatrictemporarilyhospitalitypoliticallypreliminarypotentiallysympatheticimmortalityvoluntarilygeneticallyprobabilityfinanciallyaccordinglyheavyweightbabysittinguncertaintycontinuallynationalitydaydreamingmomentarilycalligraphybeneficiaryrespiratoryreactionaryspiritually
...View all with 11 letters...
Phrases (343)
grass familylaying claimhigh qualityin a broad waylaying wastelouis leakeybryonia albaadmiral byrdsensory hairplaying area
...View all with 11 letters...
Words (1782)
particularlypsychiatristspecificallyaccidentallyoccasionallydeliberatelychristianityincreasinglypennsylvaniaincidentallyunbelievablyevolutionarydramaticallydisciplinarypassionatelypenitentiarysatisfactoryhypocriticalspiritualityaccompanyingstraightawayindividuallymunicipalityconsiderablymiraculouslyencyclopediahypotheticalhistoricallyaggressivelyeconomicallyauthenticitymetaphysicalunofficiallyromanticallymythological
...View all with 12 letters...
Phrases (458)
staying powervisual acuityscantily cladwilliam wyleradmiral deweyread-only fileshaking palsysquirrel awayadmiralty lawmyrtle family
...View all with 12 letters...
Words (1667)
extraordinarypsychologicalrevolutionaryapproximatelyautomaticallyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallysignificantlystatisticallytraditionallydysfunctionalvulnerabilityautobiographycontradictoryappropriatelyindividualitycomplimentaryparliamentaryinadvertentlyradioactivityfantasticallyphysiologicalpsychosomaticsubstantiallygynaecologistrealisticallyprecautionarycompatibilitystrategicallypredominantlyhypochondriacexponentially
...View all with 13 letters...
Phrases (546)
harvey cushingaleatory musicel iskandriyahfamily laridaevaginal arterydirect antonymauditory sensegilbert murrayfamily picidaein a similar way
...View all with 13 letters...
Words (1232)
simultaneouslyprofessionallyscientificallyhypotheticallycinematographypsychoanalysissystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallyaccountabilitydemocraticallysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallysustainabilityunquestionablyintentionalityinterplanetarycardiomyopathyastrophysicistunsatisfactoryconfidentiallypathologicallythermodynamicsterritorialityhyperventilateproportionallyexcruciatinglyconservativelypsychoanalytic
...View all with 14 letters...
Phrases (667)
family apiaceaepearl mae baileythoracic cavitymoonseed familyorder mysidaceawilliam tyndalefamily ardeidaemyrrhis odoratapituitary dwarfpituitary gland
...View all with 14 letters...
Words (897)
psychologicallyconfidentialityextraordinarilyinternationallyunconditionallypsychotherapisttechnologicallyunintentionallyinstantaneouslysynchronizationenvironmentallyinappropriatelyanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitychronologicallysympathomimeticsynergisticallyinaccessibilityincompatibilitycrystallizationintellectualityparentheticallyplenipotentiarysuppositionallymicroscopicallyaerodynamicallyproportionatelymaneuverabilitycardiopulmonarytherapeuticallysynchronisationdisappointingly
...View all with 15 letters...
Phrases (803)
syringa vulgarisauditory ossicleby fits and startsstay of executionalimentary pasteasamiya languagedialysis machinefamily tinamidaeannunciation daymount nyiragongo
...View all with 15 letters...
Words (371)
enthusiasticallyindiscriminatelyconstitutionallycatastrophicallytriphenylmethaneunpredictabilityhyperventilationpsychoanalyticalquintessentiallyphylogeneticallyjournalisticallynonrevolutionarycircumstantiallypharmaceuticallymonosyllabicallyerythroblastosisunapologeticallythermostaticallysurrealisticallypsychobiologicalthrombocytopeniaphotographicallyunprofessionallyinconceivabilityparapsychologistconversationallyneuropsychiatricdiscriminatorilyhypersalivationsinextinguishablyparadigmaticallypornographicallycolorimetricallyexterritorialityjurisdictionally
...View all with 16 letters...
Phrases (739)
tympanic membranein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaecapital of hungarydefinite quantitywilliam wycherley
...View all with 16 letters...
Words (230)
straightforwardlyunconventionalitybacteriologicallyconstitutionalityanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryantirevolutionaryhyperreactivitiesself-contradictoryradiobiologicallyisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilitykaleidoscopicallyradioimmunoassaysradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionally
...View all with 17 letters...
Phrases (737)
mary leontyne pricedivision bryophytasalvia leucophyllabalaena mysticetusczech monetary unitlycopodium alpinumhypoglycemic agentcuban monetary unitinterstate highwaypearly everlasting
...View all with 17 letters...
Words (114)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalpolyesterificationhypersensitizationspectroheliographymultifunctionalitypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricitycylindrical-stemmedlaryngopharyngitislipopolysaccharidepostpsychoanalyticunconstitutionallylymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicaltransformationallycalymmatobacteriumstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylurearecrystallizations
...View all with 18 letters...
Phrases (717)
bombycilla cedrorunbombycilla garrulusrevolutionary groupadministrative bodydivision anthophytafamily physeteridaedame sybil thorndikeeriobotrya japonicalachrymal secretiondivision cynodontia
...View all with 18 letters...
Words (82)
hyperparathyroidismhydrochlorothiazidepsychophysiologicalcinematographicallypolyesterificationshypersensitizationsextralinguisticallyotorhinolaryngologyextraterritorialityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalitycytodifferentiationconceptualisticallycytopathogenicitiesindividualisticallybacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedchromoblastomycosisinterdepartmentallyelectromagnetically
...View all with 19 letters...
Phrases (627)
water-plantain familyacetylsalicylic acidfamily cyclopteridaescandinavian countryfamily cynoglossidaeitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glaciergiles lytton strachey
...View all with 19 letters...
Words (46)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolradioimmunoassayableparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilitycytodifferentiationsimmunocytochemicallylymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityultramicroscopicallyelectrophysiologicalmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazides
...View all with 20 letters...
Phrases (520)
william stanley jevonshonduran monetary unityellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridae
...View all with 20 letters...
Words (20)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologiststereomicroscopicallymucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (364)
icelandic monetary unitnikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unit
...View all with 21 letters...
Words (7)
spectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (297)
venezuelan monetary unithaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcesubfamily bassariscidae
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (215)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusparis-sorbonne universitykyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unit
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (157)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytis
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (111)
myroxylon balsamum pereiraeigor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencypolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline system
...View all with 25 letters...
Phrases (88)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrand
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (68)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (55)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (36)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (31)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (21)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyer
...View all with 31 letters...
Phrases (23)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (18)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (14)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciences
...View all with 37 letters...