Words Containing: Y,A,R,T,A
(In Any Order)
There are 2,002 words,
3,100 phrases and
0 abbr's with
Y,A,R,T,A in.
Best Scoring Words With: Y,A,R,T,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
ataraxy | 7 | 17 | nounn | |||||
noun • Freedom from mental disturbance; imperturbability, dogged indifference. | ||||||||
tramway | 7 | 15 | nounn | |||||
noun • a conveyance that transports passengers or freight in carriers suspended from cables and supported by a series of towers • the track on which trams or streetcars run | ||||||||
partway | 7 | 15 | adverb, adjectiveadv, adj | |||||
adverb • To some extent. • In part. | ||||||||
autarky | 7 | 14 | noun, adjectiven, adj | |||||
noun • economic independence as a national policy | ||||||||
ashtray | 7 | 13 | nounn | |||||
noun • a receptacle for the ash from smokers' cigars or cigarettes | ||||||||
rhatany | 7 | 13 | nounn | |||||
noun • The powerfully astringent root of a half-shrubby Peruvian plant (Krameria lappacea, syn. Krameria triandra), used in medicine and to colour port wine. | ||||||||
actuary | 7 | 12 | noun, adjectiven, adj | |||||
noun • someone versed in the collection and interpretation of numerical data (especially someone who uses statistics to calculate insurance premiums) | ||||||||
amatory | 7 | 12 | adjectiveadj | |||||
adjective satellite • expressive of or exciting sexual love or romance | ||||||||
ratably | 7 | 12 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
lactary | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (62)
saturdaybetrayalstairwaysanitarylavatorytaxpayerwarrantyguarantywaterwaystatuaryboatyardsalutaryastrallyalacritybarratrysanatorybastardystannaryrapacityautarchyacrylatecaryatidcavitarycalyptraarythmiatrackwaynatatoryaleatoryauralityrateablyashtraystanyardstearawaytrainwaydaystars
...View all with 8 letters...
Phrases (16)
altar boyturn awayalms traytea partydelta raytear awaya batteryparty manmanta raywar party
...View all with 8 letters...
Words (125)
naturallysanctuarymandatorypartiallyfairytaleplanetaryarbitraryadmiraltyportrayalgallantrydastardlyparalyticthrowawaybarbarityautocracypageantryrascalitylaterallypeasantrypaymasterplayactorcatalyzerthackerayradiantlycarnalitysaltatorymayoraltypantrymanantiquaryamoralitydamnatorylaudatoryplacatorymaritallytabularly
...View all with 9 letters...
Phrases (33)
salary cutrate of paycary grantprayer matright awaybay staterbay wreathat any ratemarket daystay relay
...View all with 9 letters...
Words (180)
apparentlylaboratoryseparatelyaccuratelytragicallyrationallystationarypythagorasarrhythmiaunsanitarytyrannicalcautionaryarchetypalyardmasterarrogantlymateriallypatriarchyapothecaryflagrantlydramaturgyabstractlypleasantryalimentaryambulatorymatriarchydefamatorycharitablyaccusatoryinsanitarydysarthriasatyagrahasatyriasismagistracylaparotomypartiality
...View all with 10 letters...
Phrases (47)
carya ovatabarter awaylead astrayparty favorgray marketgray matterthomas graytwyla tharpquarter daymary martin
...View all with 10 letters...
Words (235)
practicallyreactionarydrasticallyaristocracyclairvoyantfamiliarityabnormalityfranticallyarbitrarilyrationalityexplanatorypreparatoryerraticallymaterialitytachycardiaretaliatoryunnaturallyelaboratelypythagoreanalternatelyantigravitytyrannosaurancestrallyfragmentaryinfantrymanvariabilitycartographysartoriallyadorabilityactuariallyaortographysteeragewayunalterablyantislaveryparathyroid
...View all with 11 letters...
Phrases (77)
oryza sativavictoria daylaundry cartbattle royalparaguay teaparty favourmathew bradygravity wavemilitary manveterans' day
...View all with 11 letters...
Words (292)
particularlydramaticallysatisfactorystraightawayromanticallyartificiallyparamilitarytransylvaniainflammatorytransparencyartisticallyasymmetricalaromatherapyprobationaryunilaterallyconstabularyimpartialitybreathalyzercarbohydrateartillerymantheatricallymasturbatoryirrationallypracticalityradiotherapyattractivelyparalyzationinflationarybreathalyserhyponatremiacollaterallyarticulatoryinaccuratelyantimilitaryarchetypally
...View all with 12 letters...
Phrases (113)
mary mccarthyadmiralty lawmaterial bodychristmas dayacrylic paintlienal arterywatch crystaldramatic playsalivary ductmathew b. brady
...View all with 12 letters...
Words (323)
extraordinaryapproximatelytraditionallytyrannosaurusautobiographyappropriatelyparliamentaryradioactivityrealisticallyprecautionarystrategicallycategoricallyspectacularlycomparativelysarcasticallyalternativelycontractuallyirrationalitygrammaticallymarketabilityparticularityhallucinatoryextravagantlyaffirmativelytheatricalityarchaeopteryxadrenalectomypatrioticallypolycarbonatetransparentlyartificialityparticipatorycyanobacteriadiametricallyanthropophagy
...View all with 13 letters...
Phrases (169)
aleatory musicvaginal arteryspiny anteatercygnus atratusprivate treatycardiac rhythmadmiralty milebarbary pirateacrylate resinpraying mantid
...View all with 13 letters...
Words (243)
cinematographymetaphoricallyunderstandablydemocraticallyinterplanetarycardiomyopathypancreatectomyunsatisfactorycongratulatorycharacterologysupernaturallysatisfactorilyastronomicallyappreciativelyaltruisticallyimpracticalitydepartmentallyarchetypicallyastrologicallychromatographyautocraticallyasymmetricallypachydermatouspracticabilityunalterabilityinarticulatelyheavyheartedlygenerationallypleasurabilitygreatheartedlyaxisymmetricalupgradeabilityarithmeticallyinalterabilitymoralistically
...View all with 14 letters...
Phrases (188)
thoracic cavitymyrrhis odoratapituitary dwarftubal pregnancypituitary glandsabbatical yearadmiralty brassnavy departmentadmiralty metalx-ray photograph
...View all with 14 letters...
Words (222)
extraordinarilyinternationallyinappropriatelycrystallizationparentheticallymaneuverabilitytherapeuticallyunparliamentarydramaturgicallypolyunsaturatedinspirationallylogarithmicallygastronomicallyauthoritativelycrystallographyarchitecturallyheartbreakinglyritualisticallypsychiatricallytemperamentallyultrasonographyagranulocytosisapproachabilityunextraordinaryunadulteratedlymicroanalyticalalgorithmicallymerchantabilitymarriageabilityautotetraploidyincomparabilityelectroanalysishypersalivationperipateticallyradioautography
...View all with 15 letters...
Phrases (242)
by fits and startscentaurea cyanuscharlotte cordayalimentary pasteby trial and errorfamily artamidaeadmiralty islandlycosa tarentulafamily triglidaejoyce carol oates
...View all with 15 letters...
Words (109)
catastrophicallyjournalisticallycircumstantiallypharmaceuticallythermostaticallysurrealisticallyphotographicallyparapsychologistconversationallyhypersalivationsparadigmaticallyantistrophicallyextracorporeallyparamagneticallynonparticipatoryparaphrasticallyadministrativelyparasympatheticsarchaeoastronomybureaucraticallyorganizationallycrystallizationsrechromatographystenographicallycrystallographiclithographicallyflabbergastinglyastrophotographyperiphrasticallymultifactoriallyrelativisticallyprotoarchaeologyhydrocharitaceaearistocraticallymacrophotography
...View all with 16 letters...
Phrases (227)
tympanic membranein a beastly manneritalian greyhoundcapital of hungaryin all probabilityin an elaborate wayvariable quantityrelative majoritycommercial treatyautogenic therapy
...View all with 16 letters...
Words (66)
straightforwardlybacteriologicallyanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyphilanthropicallyprobabilisticallyantirevolutionaryradioisotopicallyparapsychologistsparasitologicallymonochromaticallyrationalisticallypaternalisticallymammothermographyarchitectonicallyferrimagneticallyunderstandabilityidiosyncraticallycrystallographerscrystallographiesuntranslatabilitytranscriptionallyhyperalimentationtransdisciplinarylymphogranulomatacounterfactualitymacroevolutionaryrecrystallizationconfigurationallybathythermographstransplantability
...View all with 17 letters...
Phrases (262)
dame margot fonteyncuban monetary unitinterstate highwaypearly everlastingcoccygeal vertebrasubphylum craniatacylinder separatorfamily trochilidaecapital of marylandmountain cranberry
...View all with 17 letters...
Words (35)
characteristicallyhypercoagulabilityinterchangeabilityhypoparathyroidismlaryngopharyngitistransformationallycalymmatobacteriumautobiographicallypteridospermaphytadiethylmalonylurearecrystallizationssaccharomycetaceaepheochromocytomataspectrographicallyaerothermodynamicsrepresentationallyultracentrifugallymetallographicallyheavyheartednessesultrarevolutionarypropagandisticallyrhabdomyosarcomatapalaeoanthropologycryptogrammataceaepseudoparenchymatahydrometallurgicalintraventricularlydiethylcarbamazinehyperalimentationscorynebacteriaceaeclaustrophobicallyhypernationalisticpolychromatophiliahyperpolarizationshyperrationalitiesPhrases (286)
administrative bodyfamily physeteridaeeriobotrya japonicalachrymal secretiongenus styracosaurusafghan monetary unitjohn orley allen tatemary wollstonecraftfamily trichechidaemetric capacity unit
...View all with 18 letters...
Words (28)
hyperparathyroidismcinematographicallyextralinguisticallyextraterritorialityparathyroidectomiesparthenogeneticallyhypoparathyroidismsnonrelativisticallymagnetohydrodynamicphenylthiocarbamidechromatographicallymercury-contaminatedinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropocentricallyanthropomorphicallycharacterologicallycortico-hypothalamichistoriographicallyparasympathomimeticdiethylcarbamazinesphytogeographicallycounterinflationarytetramethyldiarsineelectrocardiographypolychromatophiliasPhrases (248)
water-plantain familyfamily cyclopteridaescandinavian countryitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glacierphytolacca americanazairese monetary unitfamily dasyproctidae
...View all with 19 letters...
Words (23)
uncharacteristicallyoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallylymphogranulomatoseslymphogranulomatosisphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallyphotoautotrophicallymagnetohydrodynamicsultramicroscopicallyroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatouspsychopharmacologistsyncategorematicallyhypercoagulabilitiespalatopharyngoplastyplethysmographicallyhyperparathyroidismsPhrases (261)
honduran monetary unitorder mycelia steriliamalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridaemarchantia polymorphadivision tracheophytadianthus caryophyllus
...View all with 20 letters...
Words (7)
acetylcholinesteraseselectromyographicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (196)
icelandic monetary unitaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unithungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecturetanzanian monetary unit
...View all with 21 letters...
Words (5)
pentamethylenetetrazolelectroencephalographyotorhinolaryngologicalhexamethylenetetramineencephalomyocarditisesPhrases (150)
venezuelan monetary unithaliaeetus leucorhyphushydrated aluminium oxidealeksandr i. solzhenitsynaccessory before the factfamily dendrocolaptidaeguatemalan monetary unitrhythm and blues musiciannicaraguan monetary unitsurinamese monetary unit
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (128)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandyellowstone national parkkazakhstani monetary unitkyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unitsouth korean monetary unittajikistani monetary unit
...View all with 23 letters...
Words (4)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyschizosaccharomycetaceaePhrases (87)
louis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisantiarrhythmic medicationtechnology administrationanal retentive personality
...View all with 24 letters...
Words (1)
uvulopalatopharyngoplastyPhrases (75)
mary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencymelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (56)
hunting and gathering societysecretary of veterans affairsevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitationbureau of diplomatic securitysystem of weights and measuresentandrophragma cylindricumbenign prostatic hyperplasia
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (43)
business environment analysisamerican revolutionary leaderorder of our lady of mount carmelco-operative republic of guyananuclear regulatory commissionsecretary of commerce and labortricyclic antidepressant drugcryptobranchus alleganiensistaras grigoryevich shevchenkostationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (29)
cardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leagueface-amount certificate companyrevolutionary proletarian armysmall computer system interfacepalestinian national authoritynonsteroidal anti-inflammatory
...View all with 28 letters...
Phrases (24)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaecalymmatobacterium granulomatis
...View all with 30 letters...
Phrases (17)
great smoky mountains national park2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (18)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lightoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuseinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (12)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdefense advanced research projects agencyus army criminal investigation laboratory
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay