Words Containing: Y,A,G,I
(In Any Order)
There are 3,187 words,
2,208 phrases and
0 abbr's with
Y,A,G,I in.
Best Scoring Words With: Y,A,G,I
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| highway | 7 | 20 | nounn | |||||
noun • a major road for any form of motor transport | ||||||||
| gauzily | 7 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| glazily | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| yakking | 7 | 19 | verb, adverbv, adv | |||||
noun • noisy talk • large long-haired wild ox of Tibet often domesticated verb • talk profusely | ||||||||
| gawkily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| taxying | 7 | 18 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| yacking | 7 | 17 | verb, nounv, n | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
| yaffing | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| magnify | 7 | 16 | verbv | |||||
verb • increase in size, volume or significance • to enlarge beyond bounds or the truth • make large | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yagiWords (102)
playingstayinghighwaygravityyappingimageryyawningslayingangrilymagnifyvaryingyakkingagilitystygiangrayishphrygiagratifygainsayspayingbabyingagilelymyalgiagaudilysyringagrayingyeaningprayinggauzilyclayingyankinggawkilyswayingsayingsdrayingallying
...View all with 7 letters...
Phrases (1)
give wayWords (217)
anythingcarryingmarryingannoyingalmightydaylightegyptianpartyingapplyingyearningsprayingstingraygiveawayrallyingstrayinglegalitygratuitydallyingplaygirlrelayingfancyingtarryingbelayingallayingreadyingyachtinggraylingtallyinglayeringungainlyachinglyridgewaybandyingcaddyingvinegary
...View all with 8 letters...
Phrases (5)
sign awayditty baggive awaylaying onmagic eyeWords (354)
imaginaryyggdrasilillegallyamazinglybiographyanalyzingmagicallyhemingwaylogicallygymnasiumpiggybackdaylightsplaythinganalysingambiguityvulgarityradiologydigitallymigratoryeasygoingoligarchyfragilitydignitaryvaryinglyglaringlypygmaliongymnasticbypassingsparinglypacifyingquarryingzygomaticgainfullyhaltinglyparleying
...View all with 9 letters...
Phrases (24)
loya jirgagrey friarright awayegg layingivy leagueeasy goingboxing dayholy grailbilly goatparty girl
...View all with 9 letters...
Words (420)
originallysatisfyinggymnasticstragicallyyugoslaviamagnifyingobligatoryqualifyinggraciouslynegativitygratifyingnegativelysurgicallyplaywrightlegitimacyscathinglyportrayingcharminglyregularitycardiologyclarifyingdiagonallysingularlyfalsifyingannoyinglyoverpayingdynamitinglaryngitisalarminglyillegalityprofligacystraightlyparalysingmenacinglypolygamist
...View all with 10 letters...
Phrases (45)
maxim gorkydry wallingwedding dayhanging flyivy leaguerpaying backfading awaylady godivaglycine maxglyptic art
...View all with 10 letters...
Words (444)
geneticallyaccordinglyheavyweightbabysittingdaydreamingcalligraphyoriginalitysingularityiconographyorganicallyinteragencyyugoslavianappallinglyplaywritingangelicallydehydratingantigravitycarriagewaygeophysicalgraphicallyquantifyinghypogastricmalignantlycopycattingindignantlymagnanimityclimatologyunceasinglyangioplastyirregularlyclassifyingunfailinglytypographicgrandiositylithography
...View all with 11 letters...
Phrases (93)
grass familylaying claimhigh qualitylaying wasteplaying areadry cleaningrunning playbilly grahamafrican greymemory image
...View all with 11 letters...
Words (414)
increasinglyaccompanyingstraightawayaggressivelymythologicalbiologicallyfigurativelylegitimatelyunsatisfyingunimaginablycongenialityecologicallyungraciouslystaggeringlyirregularitybibliographyenchantinglymagneticallygeologicallysuperhighwaydespairinglylogisticallyhygienicallyhypoglycemiahypogonadismhydrographicillegitimacylollygaggingstylographicetymologicalunwaveringlygratifyinglygratuitouslyastrobiologybullyragging
...View all with 12 letters...
Phrases (116)
staying powershaking palsygenus syringainquiry agentbaby carriagegenus cydoniapolicy changeacid hydrogenginkgo familyfrighten away
...View all with 12 letters...
Words (388)
psychologicalsignificantlyautobiographyphysiologicalgynaecologiststrategicallycategoricallymagnificentlyastonishinglyeverlastinglyideologicallypainstakinglyoveranalyzinggrammaticallyhypoglycaemicinfuriatinglyenergeticallygynecologicaldisparaginglydeoxygenationhumiliatinglymeaninglesslytypographicaldisgracefullygeometricallycrystallizingtheologicallymagisteriallyfascinatinglyunoriginalityhydrogenationoverbearinglynostalgicallydillydallyingmyoglobinuria
...View all with 13 letters...
Phrases (146)
harvey cushingvaginal arterygilbert murrayhigh-and-mightydwindling awaypraying mantidradiant energygenus acinonyxsalivary glandgenus martynia
...View all with 13 letters...
Words (307)
cinematographygeographicallypathologicallyexcruciatinglygynaecologicalembarrassinglylinguisticallysociologicallyentertaininglybiographicallydiagnosticallyastrologicallyanesthesiologyetymologicallydisapprovinglyhistoriographyunhesitatinglyethnologicallymagniloquentlyillegitimatelyimpregnabilitygenerationallyinsignificancylightheartedlyinfrangibilitydiscouraginglydisquantityinghypoallergenicinvigoratinglyupgradeabilitygenealogicallycryobiologicalegocentricallyintimidatinglyacceleratingly
...View all with 14 letters...
Phrases (173)
pituitary glandigor stravinskydrainage systemprogram librarymargin of safetyrudyard kiplinganser cygnoidesegyptian cottonmagnolia familyfagus sylvatica
...View all with 14 letters...
Words (241)
psychologicallytechnologicallyanaesthesiologyphysiologicallychronologicallysynergisticallydisappointinglycytomegalovirusrecrystallizingdramaturgicallylogarithmicallytransmogrifyinggastronomicallyseismologicallygynandromorphicdemographicallyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitycommiseratinglyalgorithmicallyphysiographicalpsychoanalyzingmarriageabilitydisenchantinglydishearteninglynonbiologicallyphytopathogenichyperaggressivedistinguishablyradioautographydaguerreotypisthydrobiological
...View all with 15 letters...
Phrases (197)
syringa vulgarisasamiya languagemount nyiragongomail-order buyinggenus sylvilagusgenus bombycillahyoscyamus nigerfamily triglidaedasyprocta agutigenus cyanocitta
...View all with 15 letters...
Words (106)
phylogeneticallyunapologeticallypsychobiologicalphotographicallyparapsychologistinextinguishablyparadigmaticallypornographicallyparamagneticallyradiographicallyotolaryngologistmicrogametophytehyperstimulatingparapsychologieshyperventilatingphotolithographynonpsychologicalarchaeologicallypathophysiologichemoglobinopathycriminologicallycrossopterygiansorganizationallyichthyologicallyiconographicallylyginopteridalesstenographicallyhypopigmentationcrystallographiclithographicallyflabbergastinglynonsignificantlyflexographicallystereoregularityindefatigability
...View all with 16 letters...
Phrases (200)
italian greyhoundstrictly speakingchristian huygenscapital of hungarycardiac glycosidecygnus buccinatorcommercial agencyalan lloyd hodgkindwight lyman moodyautogenic therapy
...View all with 16 letters...
Words (70)
straightforwardlybacteriologicallyanthropologicallyradiobiologicallyunexchangeabilityparapsychologistsparasitologicallypathophysiologiesferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologylymphangiographiccytomegalovirusescytopathogenicityconfigurationallypharmacologicallyimmunogeneticallyelectronegativityoceanographicallybibliographicallyzoogeographicallysamoyedic-speakingphonocardiographyglycosaminoglycantrigonometricallychromolithographyotolaryngologicalotolaryngologistsdisadvantageouslygynandromorphismselectromyographicmetapsychologicalsuperheavyweights
...View all with 17 letters...
Phrases (187)
hypoglycemic agentinterstate highwaypearly everlastingmalaysian languagetheological systemantipsychotic drugcylindrical liningrepublic of hungarytypha angustifoliayeniseian language
...View all with 17 letters...
Words (40)
hypercoagulabilitypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalspectroheliographysphygmomanometriespathophysiologicallaryngopharyngitislymphangiographiesautobiographicallydistinguishabilitymagnetostrictivelyphenomenologicallyophthalmologicallygeochronologicallyglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesiselectromyographiesultracentrifugallymetallographicallydemythologizationspropagandisticallyrhinolaryngologistroentgenologicallyhistophysiologicalhydrometallurgicalpsychobiographicalsedimentologicallyhydrometallurgistsphysiopathologicalindiscriminatingly
...View all with 18 letters...
Phrases (225)
bombycilla garrulusrevolutionary groupfreudian psychologyafghan monetary unitnavigational systemfamily asparagaceaeantipsychotic agentfamily polygalaceaegenus chamaecytisusfulminating mercury
...View all with 18 letters...
Words (25)
psychophysiologicalcinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallycytopathogenicitiesmagnetohydrodynamicchromatographicallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectroretinographycharacterologicallyhistopathologicallyhistoriographicallyhydrometeorologicalpsychopharmacologicsymptomatologicallyphytogeographicallyphytohemagglutininssociolinguisticallypaleogeographicallyelectrocardiographyPhrases (164)
family cynoglossidaealpine type of glaciergiles lytton stracheygenus symphoricarposbond-trading activitycapital of kyrgyzstanavogadro's hypothesissalicylate poisoninghydrobates pelagicusuniversity of chicago
...View all with 19 letters...
Words (15)
crystallographicallyindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalroentgenographicallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (129)
oryctolagus cuniculusclyde william tombaughbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosfamily gasterosteidaeunabridged dictionarymilitary intelligenceglycerol tripalmitate
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychophysiologicallyclinicopathologicallyPhrases (107)
igor ivanovich sikorskybulgarian monetary unithungarian monetary unitextrauterine pregnancycynoglossum officinaleginglymostoma cirratumnorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaard
...View all with 21 letters...
Words (3)
otorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyPhrases (85)
guatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitamygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellingtonbahasa malaysia language
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (56)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinsir terence mervyn rattigantechnology administrationfederal republic of germanyandrei andreyevich gromykopaul johann ludwig von heyseposterior meningeal arterydivision gymnospermophyta
...View all with 24 letters...
Phrases (25)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencybeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska rivercygnus columbianus bewickii
...View all with 25 letters...
Phrases (29)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (28)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianusimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (12)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planningnorth atlantic treaty organization
...View all with 31 letters...
Phrases (11)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusnonsteroidal anti-inflammatory drugprimary subtractive colour for lightyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united statesbosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
