Words Containing: T,R,I,P,E,Y
(In Any Order)
There are 1,725 words,
1,586 phrases and
0 abbr's with
T,R,I,P,E,Y in.
Best Scoring Words With: T,R,I,P,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| petrify | 7 | 15 | verbv | |||||
verb • cause to become stonelike or stiff or dazed and stunned from fright • change into stone • make rigid and set into a conventional pattern | ||||||||
| pyretic | 7 | 14 | adjectiveadj | |||||
adjective • causing fever | ||||||||
| pyrites | 7 | 12 | nounn | |||||
noun • any of various metallic-looking sulfides (of which pyrite is the commonest) | ||||||||
| yperite | 7 | 12 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| pyrite | 6 | 11 | nounn | |||||
noun • a common mineral (iron disulfide) that has a pale yellow color | ||||||||
| typier | 6 | 11 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (55)
privatelyhypocritepaternityposteritydepravityproprietyprettyingprecocityinterplayexpiatorypainterlytypewritepriestleypuerilityperistylelinotyperprenotifypellitorysupercitypredacityperimetrypterygiumsyrupiestpyrethrinpropyliteeurytopictypifierssplinteryprettyishpretypingpterygialpterygoidvaritypedvaritypesoperosity
...View all with 9 letters...
Phrases (4)
write copystrike payparty linepetit juryWords (119)
prosperitytypewriterencryptionperpetuityprehistorydepositorycopywriterrepositorypropensityperversityintrepidlyunpriestlydepositaryhypertonicdecryptionpernicketyinexpertlyspirometryperplexitydepilatoryexpiratoryspiritedlypetrifyingputrefyingepistolarysphericityexpositorypreciositypertinencybaptisterypanegyristpyrolusitehermatypichypocritespyrethroid
...View all with 10 letters...
Phrases (13)
private eyeiron pyritecopy editorpernyi mothtin pyritesepic poetrytriple playvery pistolparty linertorrey pine
...View all with 10 letters...
Words (204)
personalitytemporarilysuperiorityrespiratoryhypothermiahyperactiveproprietaryserendipitycopyrightedsympathizerhypothermicpredictablyreciprocitytypewritingpersnicketypeculiarityimproprietyprominentlyprimitivelyintrepidityimperfectlysympathisertypewrittenprematuritypersistencycryptogenicprettifyingsuperfluityreceptivitypyrotechnicretinopathyproselytizeimprudentlypremonitoryoperatively
...View all with 11 letters...
Phrases (17)
dinner partyx-ray picturepoverty lineparity checktyping paperpanther lilytorrey's pinepanty girdletipper lorryplain turkey
...View all with 11 letters...
Words (252)
penitentiaryhypertensionrespectivelypresbyterianpersistentlyhypochloritehypertensivepyrotechnicspraiseworthyproficientlyhyperaciditypejorativelyradiotherapystereotypinghyperthermiahypertrophicrespirometryhyperthyroidpsychometricstreptomycinhyponatremiahyperkineticpermittivityrehypnotizedperceptivelypermeabilityperemptorilyrepetitivelyperspicacityproductivelyimperativelyarchetypicalephemeralitydepreciatorycorporeality
...View all with 12 letters...
Phrases (45)
molly pitcherstaying powerpoetic rhythmtennis playerin perpetuitypetit larcenyfifty percentpoint of entryheroic poetrycandy striper
...View all with 12 letters...
Words (288)
approximatelyappropriatelycomplimentaryparliamentaryprecautionarypredominantlyphysiotherapycomparativelystereotypicalexpeditionaryhyperactivityimperceptiblyprovocativelypredominatelypicturesquelysuperlativelyperspectivelyimpertinentlypretentiouslyimmunotherapyhypertrophiedhypervelocitypropheticallyprecipitatelyunpredictablyproselytizinginopportunelyhypercriticalprohibitivelyamitriptylinepenetratinglyprecipitouslycircumspectlypresumptivelypenetrability
...View all with 13 letters...
Phrases (63)
spiny anteaterprivate treatybarbary pirateproperty rightprime quantitymemory pictureheavy particlephrygian deitylatency periodprinted symbol
...View all with 13 letters...
Words (262)
responsibilitycinematographymetaphoricallyrespectabilityhypersensitiveinterplanetaryhyperventilatepredictabilitypsychoneuroticexperimentallynephrotoxicityreproductivelyappreciativelysuperficialitypolymerizationhydropneumaticpyelonephritisprovidentiallyorthopedicallyarchetypicallyhydrotherapistpreferentiallypraiseworthilyimpermeabilitycyproheptadineimpregnabilityhyperkeratoticpleasurabilityhypermetropiassuperloyalistsupgradeabilityextemporaneityhypercriticismhyperpigmentedparametrically
...View all with 14 letters...
Phrases (73)
visual propertyprimary featherdata encryptionchristopher fryparts inventorycitellus parryipublic propertypetty criticismliterary periodpublic security
...View all with 14 letters...
Words (205)
psychotherapistinappropriatelydisrespectfullyphysiotherapistsurreptitiouslyparentheticallyplenipotentiaryproportionatelytherapeuticallyuncomplimentarypostoperativelyintrospectivelyunparliamentaryuninterruptedlyretrospectivelyneuropsychiatryinterdependencyimperishabilityhypersensitizedreproducibilityteletypewriterscomplementarityimponderabilityserendipitouslyautotetraploidyhypersalivationperipateticallypsychometriciancyproheptadinessuperplasticityhyperstimulatedhyperstimulatesdaguerreotypisthydroxylapatiteuncopyrightable
...View all with 15 letters...
Phrases (101)
alimentary pasteprivate propertystonecrop familyrhythmic patternspecific gravitybrittany spanielmagnetic pyritesdemocratic partybuttercup familycapital of turkey
...View all with 15 letters...
Words (118)
irresponsibilitytriphenylmethanehyperintelligentunpredictabilityhyperventilationimperceptibilitypharmaceuticallythrombocytopeniahypersensitivityneuropsychiatricpolydispersitieshypersalivationsparamagneticallyhypersensitizingmicrogametophytehypersexualitiesthermoplasticityhyperstimulatinghyperstimulationimperfectibilityhypersusceptibleparasympatheticshyperthyroidismshyperventilatinghyperviscositieshypervitaminosesthrombocytopeniccrossopterygiansleukodystrophiesperpendicularitycryopreservationmorphometricallylyginopteridalesstenographicallystereophonically
...View all with 16 letters...
Phrases (111)
tympanic membranestrictly speakingefficiency expertautogenic therapycapital of new yorkquaternary periodpharyngeal tonsilpolitical libertyprince albert's yewspectrum analysis
...View all with 16 letters...
Words (79)
superconductivityparathyroidectomycardiorespiratoryneurophysiologistpsychotherapeuticinterdisciplinaryhyperreactivitiesphysiotherapeuticthermoperiodicityhyperstimulationsspectroscopicallyhyperventilationsthrombocytopeniaspaternalisticallymorphogeneticallycryopreservationscryptocrystallinecrystallographiespostrevolutionarymicropaleontologydisrespectabilityhyperalimentationstereospecificitynephelometricallyptilonorhynchidaeimperialisticallyorthopsychiatriestriphenylmethaneshyperintelligencejurisprudentiallyneuropsychiatrieselectromyographicneuropsychiatristneuropsychologistimpressionability
...View all with 17 letters...
Phrases (141)
mary leontyne priceproteolytic enzymepearly everlastingcylinder separatorpetasites hybridushereditary patternuniversity of parispython reticulatuspenetrating injurypetromyzon marinus
...View all with 17 letters...
Words (41)
disproportionatelyhypercoagulabilityhyperaldosteronismhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidepsychotherapeuticssphygmomanometriesanthropocentricitytriphosphopyridinestereospecificallypteridospermaphytahypercholesteremiamyeloproliferativegranulocytopoiesesspectrographicallygranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyneuropsychiatristselectromyographiesneuropsychologistsmetallographicallyelectrophysiologicmethylprednisolonedephosphorylationsoveroptimisticallyhydroxytryptamineshyperalimentationshyperconcentrationdimethyltryptamine
...View all with 18 letters...
Phrases (154)
revolutionary groupfamily physeteridaeeriobotrya japonicaposterior pituitarysuperiority complexmetric capacity unitvictory in europe dayinfantile paralysiscapital of new jerseytypographical error
...View all with 18 letters...
Words (34)
hyperparathyroidismcinematographicallypolyesterificationshypersensitizationspolyribonucleotideshypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallybacteriochlorophyllphenylthiocarbamideinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyelectroretinographyincomprehensibilitydihydrostreptomycinparasympathomimeticoverproportionatelyphytogeographicallyhyperconcentrationshypoadrenocorticismhyperemotionalitiesdimethyltryptamineshyperexcitabilitiescytophotometricallyhyperirritabilitiesexpressionisticallyelectrocardiographyPhrases (157)
water-plantain familyfamily cyclopteridaealpine type of glacierphytolacca americanafamily dasyproctidaeavogadro's hypothesisfamily tropaeolaceaehydrobates pelagicusunix operating systemsubfamily potoroinae
...View all with 19 letters...
Words (20)
hypercholesterolemiahypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismbacteriochlorophyllsphenylthiocarbamidesoophorosalpingectomyneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallymicrophotometricallyhypercholesterolemichypercoagulabilitiesplethysmographicallyhyperparathyroidismsPhrases (126)
family trachipteridaedivision tracheophytafriendly relationshipjapanese monetary unitamyloid protein plaquetransportation systempolitically incorrectglycerol tripalmitatesupplementary benefitegyptian monetary unit
...View all with 20 letters...
Words (5)
hypersusceptibilitiesstereomicroscopicallyelectromyographicallyhypercholesterolemiaspsychotherapeuticallyPhrases (130)
extrauterine pregnancypseudemys rubriventriseucalyptus fraxinoidesisle royal national parkparty to the transactioncucurbita argyrospermaspectroscopic analysispakistani monetary unitcape verde monetary unitwhite-coat hypertension
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (98)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinathyrium thelypteroidesmale reproductive systemparaguayan monetary unit
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (71)
posterior pituitary glandyellowstone national parkparis-sorbonne universitydorothy rothschild parkergroup pteridospermaphytasciadopitys verticillatatricyclic antidepressanteastern malayo-polynesianchrysanthemum partheniumamerican federalist party
...View all with 23 letters...
Words (3)
hyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyPhrases (48)
division heterokontophytaprivately held corporationprimary sex characteristichypersensitivity reactionanal retentive personalityoxidative phosphorylationelectroconvulsive therapysuperior cerebellar arterypresident john quincy adamsposterior meningeal artery
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (40)
modest petrovich mussorgskypolystichum acrostichoidescaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentsuborder petromyzoniformespodkamennaya tunguska riverspecial theory of relativitycomplementary distribution
...View all with 25 letters...
Phrases (40)
employee stock ownership plansubdivision coniferophytinabureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmusnonthrombocytopenic purpurasuperorder labyrinthodontia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (29)
augustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteinstationary stochastic processinformation processing systemtopical prostaglandin eyedropsystema nervosum periphericum
...View all with 27 letters...
Phrases (26)
revolutionary people's struggletriphosphopyridine nucleotidecardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitydissident irish republican armyface-amount certificate companyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphism
...View all with 28 letters...
Phrases (17)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibrium
...View all with 29 letters...
Phrases (18)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborn
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
great smoky mountains national park2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositionfrequency-response characteristicPhrases (9)
weakly interacting massive particlecercopithecus aethiops pygerythrusprimary subtractive colour for lightlymphocytic choriomeningitis virusprogressive emphysematous necrosischrysanthemum coronarium spatiosumadult respiratory distress syndromecystic fibrosis transport regulatorjohn f. kennedy international airportPhrases (11)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economypositron emission tomography scanneridiopathic thrombocytopenic purpura
...View all with 33 letters...
Phrases (8)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencessixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn
