Words Containing: S,A,C,T
(In Any Order)
There are 17,930 words,
9,181 phrases and
0 abbr's with
S,A,C,T in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jackets | 7 | 20 | nounn | |||||
noun • a short coat • an outer wrapping or casing • (dentistry) dental appliance consisting of an artificial crown for a broken or decayed tooth • the outer skin of a potato • the tough metal shell casing for certain kinds of ammunition verb • provide with a thermally non-conducting cover • put a jacket on | ||||||||
thwacks | 7 | 19 | verbv | |||||
noun • a hard blow with a flat object verb • deliver a hard blow to | ||||||||
czarist | 7 | 18 | noun, adjectiven, adj | |||||
adjective • of or relating to or characteristic of a czar | ||||||||
acquest | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
acquits | 7 | 18 | verbv | |||||
verb • pronounce not guilty of criminal charges • behave in a certain manner | ||||||||
exactas | 7 | 16 | ||||||
noun • a bet that you can pick the first and second finishers in the right order | ||||||||
klatsch | 7 | 16 | nounn | |||||
noun • An informal social gathering, especially one held over coffee for the purpose of conversation. | ||||||||
oxcarts | 7 | 16 | nounn | |||||
noun • a cart that is drawn by an ox | ||||||||
wackest | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
ataxics | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (479)
stomachactressplasticscratchcrystalfascistcastingecstasytacticsscarletnutcasecoasterscatterdrasticstackedcatfishcoastalelasticatticussetbackoutcastcustardsatanicsatcheltuscanylactosecristalcastilecahootsgastricracketsascetictabascosanctumcelesta
...View all with 7 letters...
Phrases (15)
cash outcast outtea cosynut casecat scancar seatcat suittear saccat's eyesack out
...View all with 7 letters...
Words (1055)
distancesuitcaseinstanceconstantcurtainsartisticscotlanddistractdispatchpractisemustachecautiouspostcardcongratscassetteabstractobstacleancestorforecastpussycatmysticalcontrastancientsactivistcasualtymajesticsocratesecstaticcraziestsadisticchastityacousticautisticbackseatcampsite
...View all with 8 letters...
Phrases (45)
seed coatsea scoutcat's feetcat's footwar chestsnatch uptest casehouse catstamp act1st class
...View all with 8 letters...
Words (1833)
christmasfantasticsecretarychristianbroadcastassociateorchestramoustachesubstancespecialtyrealisticscatteredclassmatebackstagesocialistconstablesanctuaryconsulatespectaclescratchesstaircaseholocauststrategicauschwitzcantonesesarcasticcelestialsuffocatescapegoatbucharestanarchistancestralsyndicatenostalgicselectman
...View all with 9 letters...
Phrases (122)
salary cuttask forceput acrosssketch mapdance stepstop watchrain sticksport coatcase studysports car
...View all with 9 letters...
Words (2429)
constantlyresistanceassistancespecialisthistoricaldistractedhystericalmanchestertranscriptassociatedfascinatedscratchingconsultantmanuscriptpsychopathcontagiouscapitalismstatisticscompensateaccustomedcontestantaccusationblacksmithcapitalistgymnasticsspacecraftadolescentabstinencestructuraldescendantpharmacistsuffocatedanestheticconfiscateballistics
...View all with 10 letters...
Phrases (237)
tea essencecook straitfoster carespecial actslack waterwhite camasbacon stripcow pasturepastry cookscarf joint
...View all with 10 letters...
Words (2583)
fascinatingassociationsignificantspectacularrespectablecoordinatesmasterpiecepsychiatriccatastrophemathematicsdistractionconsolationsympatheticdisturbancesuffocatingconfiscatedconsideratetransactionspeculationtreacherousdescendantsfascinationcredentialsunrealisticconstantineatmosphericacquisitionclandestinecharismaticconstipatedstomachachesymmetricalcompensatedsuffocationdrastically
...View all with 11 letters...
Phrases (360)
catha edulisracing startslide actiongreat schismcasting lotscomte de saxesheet anchorspace writersir lancelotcastor fiber
...View all with 11 letters...
Words (2539)
conversationpsychiatristsatisfactioncompensationchristianityconservativedictatorshipbroadcastingcatastrophicenthusiasticcircumstancecivilisationconservatorysatisfactorytransactionsconsultationastronomicalconservationcombinationshistoricallyconstipationdiscriminatecardiologistmetaphysicaldisinfectantnarcissisticastrologicalcosmopolitandisplacementaristocraticsportscasterdomesticatedorchestratedpsychopathicarcheologist
...View all with 12 letters...
Phrases (496)
second adventspace shuttlemarcel proustlunar causticjacques ibertvisual acuityscantily cladcaptain hickscovered standgenus crocuta
...View all with 12 letters...
Words (2230)
circumstancessophisticatedconsiderationcontroversialmassachusettsinsignificantcompassionateconstellationschoolteacherarchaeologistsignificantlystatisticallyjustificationinconsideratedysfunctionalpsychoanalystmaterialisticcraftsmanshipfantasticallypsychosomaticchrysanthemumgynaecologistpsychotherapyrealisticallydiscriminatedstrategicallysanctimoniouslaughingstocktranscriptionresuscitationchristmastimespectacularlyscintillatingsemiautomatictransatlantic
...View all with 13 letters...
Phrases (595)
upton sinclairdwarf chestnutaleatory musicbitter cassavawhite backlashmuscular tonusfocal distancecathartes auracustody battlesystem command
...View all with 13 letters...
Words (1962)
communicationsdiscriminationconstitutionalscientificallyinfrastructurecharacteristicaccomplishmentclaustrophobiccircumstantialsystematicallyconstantinoplesophisticationclassificationapprenticeshipclaustrophobiacriminalisticscontemporariesindiscriminaterespectabilitydiscriminatingmiscalculationecclesiasticalspecializationundersecretarytranscendentalastrophysicistunsatisfactorythermodynamicscholinesteraseattractivenessconversationalscatterbrainedconservativelypsychoanalyticdiscriminatory
...View all with 14 letters...
Phrases (712)
expense accountstrait of calaisdirect contrastmarc blitzsteinmuscular tissuejacques cartiergenus sarcoptesalectoris ruffatheodor schwannbreathing space
...View all with 14 letters...
Words (1332)
congratulationspsychotherapistdissatisfactionsynchronizationpithecanthropuspersonificationunsophisticatedinconsequentialprognosticationprocrastinatingprocrastinationsympathomimeticsynergisticallyinaccessibilityschistosomiasissadomasochisticdiscombobulatedcrystallizationuncontroversialdiversificationindividualisticintellectualisminterscholasticagriculturalistneoconservativesynchronisationconservationistdiscontinuationenfranchisementcontroversiallyvasoconstrictoracquisitivenesscytomegaloviruscompassionatelyrecrystallizing
...View all with 15 letters...
Phrases (807)
auditory ossiclestay of executioniridaceous plantcentaurea cyanuscaltha palustrisalectoris graecajacques cousteaustrait of malaccacolumba fasciataprivate nuisance
...View all with 15 letters...
Words (541)
unconstitutionalenthusiasticallyindiscriminatelydisqualificationelectromagnetismundersecretariesconstitutionallytranscontinentalaustralopithecuscatastrophicallycountersignaturediscombobulationcounterespionagepsychoanalyticaluncharacteristicjournalisticallyelectromagneticscircumstantiallyvasoconstrictionovercompensationthermostaticallysurrealisticallyindiscriminationcollaborationistarteriosclerosisreclassificationcharacterisationfundamentalisticoverenthusiasticsensationalisticunattractivenessparapsychologistconversationallyacquaintanceshipcollaborationism
...View all with 16 letters...
Phrases (788)
genus utriculariamanihot esculentaatopic dermatitisgenus crassostreastrictly speakingperfective aspectfalco tinnunculusproteles cristatachristian huygenscaptain james cook
...View all with 16 letters...
Words (331)
conversationalistmisidentificationtranscendentalismconstitutionalitymaterialisticallyconsubstantiationcardiorespiratoryelectrostaticallycontemporaneouslyinconsequentiallytranscendentalistcompartmentalisedpsychotherapeuticmultidisciplinaryprobabilisticallyuncomfortablenessinterdisciplinaryhyperreactivitiesnonmathematiciansself-contradictorycountersignaturesmiscommunicationsantischizophreniainextricabilitiesantischizophreniccounterstatementsisoelectronicallyphysiotherapeuticspectroheliogramscomfortablenessesspectroheliographcounterstrategiescounterstrategistleukoencephalitismispronunciations
...View all with 17 letters...
Phrases (841)
horizontal sectionwilliam stricklandcastilian languageweather forecasterlarix occidentalisrobert falcon scottgenus ceratosaurusbalaena mysticetuscivil rights leaderlandscape painting
...View all with 17 letters...
Words (193)
telecommunicationscharacteristicallyinconsequentialityoversimplificationtransmogrificationpsychopathologicalantivivisectionistdisenfranchisementpaleoclimatologistpolyesterificationradiochromatogramscommensurabilitiesmisidentificationsspectroheliographscommercializationscounterstrategistsspectroheliographythermoplasticitiesunpredictabilitiesrambunctiousnessesarteriolosclerosisappreciativenessesmonochromaticitiespsychotherapeuticscompanionabilitiesparticularizationsarchaeoastronomiescompartmentalisingpathophysiologicalultranationalisticpentachlorophenolsrechromatographiescylindrical-stemmedpostpsychoanalyticmulticellularities
...View all with 18 letters...
Phrases (803)
oceanites oceanicusisabella i of castileanamnestic reactionscandinavian nationbackspace characterlachrymal secretiondivision cynodontiagenus styracosaurusdivision eubacteriaimperfective aspect
...View all with 18 letters...
Words (128)
countertransferencesternocleidomastoidpolyesterificationsdisenfranchisementsextralinguisticallycountersurveillanceantivivisectionistsparathyroidectomiessurface-assimilativecommunicativenessescrosslinguisticallynonrelativisticallycompassionatenessesencephalomeningitiscomplementarinessessmall-capitalisationsmall-capitalizationdisrespectabilitiesunconstitutionalityposttranscriptionalresorcinolphthaleincounterdemonstratoranarcho-collectivismconceptualisticallycytopathogenicitiesindividualisticallyobjectionablenessestransmogrificationsimmunohistochemicalphenomenalisticallyconsequentialnessesgastroenterologicalaccommodativenessesconstitutionalitiespseudohallucination
...View all with 19 letters...
Phrases (619)
acetylsalicylic acidmuscular contractionscandinavian countryseventeen-year locustcivil rights activisthydrastis canadensiscease and desist ordergiles lytton stracheyfamily dasyproctidaemeat-packing business
...View all with 19 letters...
Words (74)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallysemiautobiographicalspectroheliographieskeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalcountertransferencesunsatisfactorinessescrystallographicallyreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsintellectualizationsmagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesinterchangeabilitiesimmunoprecipitationsacetylcholinesterasepseudohermaphroditicoophorosalpingectomydehydrochlorinationsphosphatidylcholinesadrenocorticosteroidadrenocorticotropinsphosphofructokinasesneuropharmacologistsneuropsychiatricallycontradistinguishingultracentrifugationsmagnetohydrodynamics
...View all with 20 letters...
Phrases (555)
sweet-scented geraniumpelecanus onocrotalusgilbert charles stuartyellow-shafted flickerappendicular skeletonwyethia amplexicaulisorder mycelia steriliaabelmoschus moschatusphotographic emulsionorder myxobacteriales
...View all with 20 letters...
Words (24)
compartmentalizationsstereomicroscopicallyconstructive-metabolicinterchangeablenessesconstitutionalizationelectrocardiographiesacetylcholinesteraseselectroencephalogramscontemporaneousnessesadrenocorticosteroidsadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasescountercountermeasurepseudosophisticationsmicrominiaturizationscounterdemonstrationsunconstitutionalitieshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyunexceptionablenessestetrahydrocannabinolsPhrases (458)
acrocentric chromosomesierra madre occidentalabelmoschus esculentusfrances hodgson burnettcercopithecus aethiopshelianthemum scopariumanaphalis margaritaceadiametrical oppositionanthriscus cereifoliumhelichrysum bracteatum
...View all with 21 letters...
Words (12)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesspectrophotometricallyconstitutionalizationselectroencephalographscarboxymethylcelluloseovercommercializationselectrophysiologicallyencephalomyocarditisescountercountermeasurescounterinterpretationsPhrases (368)
administrative districtprunus persica nectarinahaliaeetus leucorhyphusadministrative officialschlumbergera truncatusherbert marshall mcluhanaccessory before the factviola tricolor hortensisteacher-student relationuniform resource locator
...View all with 22 letters...
Words (1)
carboxymethylcellulosesPhrases (279)
gilbert and ellice islandsparenthetical expressiontransient ischemic attacktribasic sodium phosphatesecond battle of el alameinsubpoena ad testificandumsir richard francis burtoncalycanthus occidentalisthryothorus ludovicianuschristoph willibald gluck
...View all with 23 letters...
Words (6)
laryngotracheobronchitiselectroencephalographerselectroencephalographiesoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (210)
carnegie mellon universitysubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwintrip the light fantastic toeprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisbrassica oleracea capitatafrancois auguste rene rodin
...View all with 24 letters...
Phrases (189)
united states secret servicecluster of differentiation 4balaenoptera acutorostratabureau of justice assistanceigor fyodorovich stravinskybureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedrafrancis scott key fitzgeraldbattle of the chemin-des-dames
...View all with 25 letters...
Phrases (123)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidconfederate states of americabacon-lettuce-tomato sandwichpolicing and enforcement costhunting and gathering society
...View all with 26 letters...
Phrases (76)
nikita sergeyevich khrushchevelectromechanical transducersolenostemon scutellarioidesdirector-stockholder relationtransmission control protocolcommissioned military officerelectronic musical instrumentnuclear regulatory commissionjerusalem artichoke sunflowersecretary of commerce and labor
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (94)
coccothraustes coccothraustesinterstate commerce commissionmarcus junius brutus the youngerstrategic arms limitation talksfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristiccardiopulmonary resuscitationmicrosoft disk operating systemcommission on the status of women
...View all with 28 letters...
Phrases (65)
business interruption insurancesecond council of constantinoplechemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disorderfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophreniadmitri dmitrievich shostakovichautomatic data processing system
...View all with 29 letters...
Phrases (50)
battle of spotsylvania court housebattle of spotsylvania courthousemusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalitybachelor of arts in library sciencecoluber constrictor flaviventrisjacques anatole francois thibaultdepository financial institution
...View all with 30 letters...
Phrases (39)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdisidonie-gabrielle claudine colettefrances elizabeth caroline willardrevolutionary proletarian nucleus
...View all with 31 letters...
Phrases (33)
patent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationcount nikolaus ludwig von zinzendorfcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylate
...View all with 32 letters...
Phrases (32)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfacebreach of trust with fraudulent intentcongress of industrial organizationslycopersicon esculentum cerasiformemusculus abductor digiti minimi manusmusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsmusculus obliquus externus abdominis
...View all with 33 letters...
Phrases (27)
jacques francois fromental elie halevyconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencescosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitz
...View all with 34 letters...
Phrases (17)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkocomte donatien alphonse francois de sadecanadian security intelligence servicenational socialist german workers' partychristopher william bradshaw isherwood
...View all with 35 letters...
Phrases (23)
center for disease control and preventionsecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewii
...View all with 36 letters...
Phrases (15)
united states declaration of independenceketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciences
...View all with 37 letters...
Phrases (10)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motieradvanced research and development activityepistle of paul the apostle to the colossiansPhrases (9)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservenucleoside reverse transcriptase inhibitorenzyme-linked-immunosorbent serologic assayPhrases (11)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventorynational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance group
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
association for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing