Words Containing: R,E,N,E,Y
(In Any Order)
There are 2,041 words,
3,137 phrases and
0 abbr's with
R,E,N,E,Y in.
Best Scoring Words With: R,E,N,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
enjoyer | 7 | 17 | nounn | |||||
noun • a person who delights in having or using or experiencing something | ||||||||
reenjoy | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
mynheer | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
recency | 7 | 14 | nounn | |||||
noun • a time immediately before the present • the property of having happened or appeared not long ago | ||||||||
greyhen | 7 | 14 | nounn | |||||
noun • female black grouse | ||||||||
regency | 7 | 13 | nounn | |||||
noun • the period from 1811-1820 when the Prince of Wales was regent during George III's periods of insanity • the period of time during which a regent governs • the office of a regent | ||||||||
fernery | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hennery | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
scenery | 7 | 12 | nounn | |||||
noun • the painted structures of a stage set that are intended to suggest a particular locale • the appearance of a place | ||||||||
beanery | 7 | 12 | nounn | |||||
noun • An inexpensive restaurant or cafe; bistro. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
reneyWords (60)
everyoneanywhererecentlyceremonyentirelyeternityserenitytenderlyeyelinerrefineryentiretygreenerypyreneesgreenwayeverymankerenskymontereyentreatyguernseyconveyeraerodyneserenelyempyreanfervencygreenflygreyhenskeynoterredyeingdeprenyldecenaryreenjoysferrymenmoneyerspyroxenelegendry
...View all with 8 letters...
Phrases (5)
zane greygreen baynew year'shenry leegreen soyWords (146)
necessaryemergencygenerallylegendaryfrequencysincerelyeternallypresentlymercenaryresidencydysenteryrepaymentjourneyedearnestlyferventlyglycerinearchenemymonterreycentenarymesenteryanywheressedentaryeyestraininverselyrelevancygreystoneabernethycoherencyremedyingpropylenetruepennyslenderlyjeeringlyjourneyerdecennary
...View all with 9 letters...
Phrases (17)
new jerseyreturn keyriver tynehenry lucebendy treeebony treetyne riverhoney bearevery inchjenny wren
...View all with 9 letters...
Words (242)
everythingscreenplayelementaryfrequentlygenerositypresidencyveterinarygenerouslyinherentlyunderbellyexternallycyberneticconverselymoneymakerconcretelythreepennyhypertenseeffronterypermanencyresiliencydegeneracycoherentlyprepaymentpernicketyinexpertlyunsurveyederlenmeyergeneralitysneeringlyreverentlyfestoonerysynaeresissyncretisesyncretizesynergetic
...View all with 10 letters...
Phrases (54)
epoxy resinbrya ebenusenergy unithoney eateryemeni rialready moneykey patternhenry jameshenry moorepaper money
...View all with 10 letters...
Words (283)
differentlynecessarilyunnecessarypermanentlysovereigntybeneficiarysynthesizerconfederacydeuteronomymoneylenderserendipityevidentiarysedimentarydeliverymanpolystyreneinteragencyboysenberrychancellerypersnicketyirrelevancyalternatelyfreemasonryerroneouslyoverpaymentdynamometernephrectomydeservinglycyberneticsteenyboppertypewrittenoveranalyzehymenopterawinterberrypersistencyexuberantly
...View all with 11 letters...
Phrases (86)
elinor wylieenergy levelroentgen rayhoney badgersingle entryfree-and-easyledger entryaeolian lyreemily brontecypress vine
...View all with 11 letters...
Words (295)
penitentiarytremendouslyrelentlesslyintermediaryhypertensionclytemnestraneurosurgeryelectrifyingpresbyterianincoherentlypersistentlyrefreshinglyhypertensiveeccentricitybelligerencyinfrequentlyextrasensoryunreservedlypolyurethanestereotypinghydrogenateddepressinglyredeploymenttetracyclinesupersensoryrecessionaryindiscreetlyhyperkineticceremoniallyrehypnotizeddysmenorrheatransverselydeterminablyinadvertencyfrenetically
...View all with 12 letters...
Phrases (119)
read-only fileearnest moneyhoneyed wordstreasury notelienal arteryyenisey rivergenus apteryxrisky venturegenus cyperustennis player
...View all with 12 letters...
Words (270)
unnecessarilyinterestinglyinadvertentlycomplementaryalternativelysupplementaryeverlastinglyexpeditionarynorthwesterlyconfectioneryindifferentlydehydrogenaseenergeticallypredominatelyeccentricallyadrenalectomyceremoniouslyunrelentinglyunconcernedlyinexpressiblyroentgenologyunrepentantlyimpertinentlyindeterminacyoverbearinglypretentiouslyreverentiallyconsideratelydeferentiallyunderhandedlynortheasterlythreateninglybelligerentlypolypropylenepenetratingly
...View all with 13 letters...
Phrases (168)
auditory senseinventory itemarnold toynbeespiny anteateralan jay lernerwaste of energyacrylate resinproperty ownerradiant energyheavy hydrogen
...View all with 13 letters...
Words (256)
electronicallyoverwhelminglyhypersensitiveinterplanetaryundersecretarypancreatectomyhyperventilatenitroglycerineintermittentlyconservativelyexperimentallygovernmentallyintermediatelyentertaininglydifferentiallyendarterectomypyelonephritisinterferometrydepartmentallymysteriousnesspreferentiallyextortionatelyoverpoweringlypreponderantlycyproheptadinecomprehensiblydepolymerizingdenumerabilityneurosecretorygenerationallybutyrophenoneshypermasculinedehydrogenaseshypoallergenicextemporaneity
...View all with 14 letters...
Phrases (195)
drunken revelrynavy departmentemergency brakecanterbury belldrainage systemchinese parsleyoriental cherryjapanese cherryoyster dressingdynamic speaker
...View all with 14 letters...
Words (180)
environmentallyparentheticallyplenipotentiarymaneuverabilityencephalographyintrospectivelyuninterruptedlydemonstrativelyunceremoniouslyheartbreakinglyunprecedentedlyinconsideratelycomprehensivelytemperamentallydiphenhydramineinterdependencyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinehypersensitizedcentrosymmetricinteruniversitysemidocumentaryheterogeneouslyunadulteratedlycomplementaritytenderheartedlyserendipitouslynonbelligerencydishearteninglyelectroanalysiscyproheptadineshypersomnolenceinterfraternity
...View all with 15 letters...
Phrases (255)
centaurea cyanusbenefit of clergyalimentary pasteebony spleenwortspiny-headed wormerlenmeyer flaskgempylus serpenscanterbury taleshoneymoon resorttietze's syndrome
...View all with 15 letters...
Words (83)
incomprehensiblytriphenylmethanehyperintelligenthyperventilationsphygmomanometerextemporaneouslyhypersensitivityheterokontophytahypersensitizinghypersomnolencesapocryphalnesseshyperventilatinghypervitaminosesperpendicularitycryopreservationlyginopteridalesstereophonicallygastroenterologyunrespectabilityoligodendrocytesmysteriousnessesphenylketonuriasphenylketonuricsgeneralizabilityneurasthenicallyheavyheartednesssyncategorematicsemitransparencyorthogeneticallydehydrogenationsmechanochemistryneurohypophysealintercrystallineprerevolutionaryinterdependently
...View all with 16 letters...
Phrases (293)
hypodermic needletympanic membranein a beastly mannerin an elaborate wayefficiency expertamerican sycamorecommercial agencynevil shute norwayautogenic therapyvery low frequency
...View all with 16 letters...
Words (57)
counterinsurgencyperchloroethylenecontemporaneouslyisoelectronicallyhyperventilationssphygmomanometerschlortetracyclineferrimagneticallymorphogeneticallycryopreservationspentylenetetrazolhyperalimentationgastroenterostomytrichloroethyleneelectronegativityelectroanalyticalnephelometricallydehydrochlorinasedehydrochlorinatetriphenylmethaneshyperintelligenceaerothermodynamicneurophysiologiesneuropsychiatriesneuropsychologiesmesembryanthemumscomprehensibilitydeoxyribonucleasepetromyzoniformeshyperpigmentationretroperitoneallymicrodensitometrydepolymerizationspalaeoethnographyintersubjectively
...View all with 17 letters...
Phrases (297)
dame margot fonteynmary leontyne priceczech monetary unitproteolytic enzymemary mcleod bethuneinterstate highwaypearly everlastingcylinder separatorcaesarian deliveryanemone sylvestris
...View all with 17 letters...
Words (51)
hyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationmethyltestosteronehypersensitivitieshypersensitizationelectrodynamometerpolyribonucleotidenoncomprehensivelysphygmomanometriespentylenetetrazolscylindrical-stemmedperchloroethyleneshyperbilirubinemiadiethylmalonylureacounterintuitivelymagnetostrictivelydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesespolypropenonitrileaerothermodynamicsrepresentationallymethylcholanthreneheavyheartednessesmethylprednisolonedeoxyribonucleasespropertylessnessesroentgenologicallypseudoparenchymatachlortetracyclines
...View all with 18 letters...
Phrases (275)
dame sybil thorndikelachrymal secretionjohn orley allen tateread-only memory chipkilocycle per secondmegacycle per secondfulminate of mercuryfamily loranthaceaeyemeni monetary unitvictory celebration
...View all with 18 letters...
Words (36)
polyesterificationshypersensitizationspolyribonucleotideshypolipoproteinemiaparthenogeneticallycytodifferentiationphenylthiocarbamideechoencephalographymercury-contaminatedelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalitymethylcholanthrenesmethylprednisolonesdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyphenylpropanolaminehydroxytetracyclinetetrachloroethylenetetrafluoroethyleneoverproportionatelydiethylcarbamazineshyperconcentrationstetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexpressionistically
...View all with 19 letters...
Phrases (245)
seventeen-year locustalpine type of glaciergiles lytton stracheyzairese monetary unitnancy freeman mitfordchinese monetary unittheory of inheritanceunix operating systemsecondary censorshipfamily zingiberaceae
...View all with 19 letters...
Words (18)
counterrevolutionaryoverenthusiasticallyhypersensitivenessespolyphiloprogenitivehyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiadeoxyribonucleotidesroentgenographicallyencephalomyocarditispseudoparenchymatoussyncategorematicallyhyperconsciousnessesdimethylnitrosaminesPhrases (224)
lebanese monetary unitbalaenoptera physalusbyelorussian languagebenjamin henry latrobeuniversity of nebraskamilton snavely hersheymagnetic bubble memoryfriendly relationshiporder actinomycetalesjapanese monetary unit
...View all with 20 letters...
Words (4)
immunocytochemistriesacetylcholinesterasespolyvinyl-formaldehydeantiferromagneticallyPhrases (161)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acidextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesextremely low frequencynorwegian monetary unit
...View all with 21 letters...
Words (6)
pentamethylenetetrazolintercomprehensibilityelectroencephalographyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (151)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (3)
polytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (107)
family threskiornithidaegeorge macaulay trevelyanmeperidine hydrochlorideyellowstone national parkparis-sorbonne universityeuropean recovery programbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridan
...View all with 23 letters...
Words (1)
hyperbetalipoproteinemiaPhrases (91)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaprivately held corporationzollinger-ellison syndromesir terence mervyn rattiganalexandre emile jean yersinfluoxetine hydrocholoridealfred edward woodley mason
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (78)
myroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencypropoxyphene hydrochloridemelanerpes erythrocephalusreligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline system
...View all with 25 letters...
Phrases (57)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (46)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (41)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Phrases (29)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (16)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (13)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuserasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (12)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (11)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencysixteen personality factor questionnaire
...View all with 37 letters...