Words Containing: L,Y,D
(In Any Order)
There are 5,110 words,
3,755 phrases and
0 abbr's with
L,Y,D in.
Best Scoring Words With: L,Y,D
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| drizzly | 7 | 29 | adverb, adjectiveadv, adj | |||||
adjective satellite • wet with light rain | ||||||||
| dizzily | 7 | 29 | adverb, adjectiveadv, adj | |||||
adverb • in a giddy light-headed manner | ||||||||
| mazedly | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
| vexedly | 7 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| dazedly | 7 | 21 | adverbadv | |||||
adverb • in a daze; in a dazed manner | ||||||||
| dialyze | 7 | 20 | verbv | |||||
verb • separate by dialysis | ||||||||
| mixedly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| dozily | 6 | 19 | verb, adverb, adjectivev, adv, adj | |||||
Valid word for Scrabble US
| ||||||||
| jadedly | 7 | 19 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (274)
alreadyholidaylaundrydisplaydelayedelderlyrapidlylindsaybradleyproudlyorderlysnidelyblindlyworldlyidyllicreadilysoundlyideallythirdlyvividlypayloaddeathlylayeredungodlyplywoodladybugweirdlydenselygrandlysolidlydualityspindlybroadlywaylaiddrywall
...View all with 7 letters...
Phrases (22)
red clayflag dayday lilylay downholy dayold ladyslide bydry cellwild ryedry kiln
...View all with 7 letters...
Words (519)
suddenlydirectlyfriendlydeliverydaylightemployedreynoldssecondlycowardlyideologyadulterylandladyanalyzedcylinderdelicacyrandomlymarylandfidelitysteadilydialysisladyshipdisloyaldecentlyladyfishstupidlytenderlyyodelingvaliditydyslexicwalleyedyieldinganalyseddistallyolympiadlucidity
...View all with 8 letters...
Phrases (49)
natal dayold styledry cleanegg yieldbandy leglive bodyiron ladylord's daybob dylanjay gould
...View all with 8 letters...
Words (628)
hollywoodgraduallylegendaryparalyzedyggdrasilevidentlyendlesslyallegedlydragonflydisplayeddiplomacyradicallyparalysedmedicallyhydraulicbollywooddaylightsadmiraltyexcitedlyhurriedlyswordplayawkwardlyradiologychlamydiadigitallydistantlydastardlyfoolhardydecidedlycordiallyliquidityroundelaycotyledonoutwardlyfederally
...View all with 9 letters...
Phrases (72)
lord byronlammas daytumble drylow comedylegal dutyadult bodyyoung ladymilk yieldfred hoyleold bailey
...View all with 9 letters...
Words (699)
definitelyincrediblyunemployedsupposedlydifficultyplaygroundrepeatedlysolidaritydisneylanddisabilityprofoundlyinfidelityunderlyingdiscreetlydeploymentdistinctlyordinarilyhydraulicsindirectlyschoolyardsleepyheaddisorderlyreportedlyunfriendlyadmittedlyneedlesslyhandsomelydreadfullydelicatelyadequatelydiligentlypiccadillysymbolizedunderbellymoderately
...View all with 10 letters...
Phrases (109)
canada lynxwoody allenfleur-de-lyswoody plantline of dutyfield pansyaniline dyelead astraydry wallingchalcid fly
...View all with 10 letters...
Words (682)
immediatelydifferentlydesperatelyundoubtedlycredibilitywonderfullyaccordinglydangerouslydrasticallyexceedinglypsychedelicdelinquencyconfidentlypterodactylmethodologymoneylenderdeliverymandeliciouslydeceitfullyskulduggerydeceptivelycontentedlydefensivelybodybuilderpredictablyvaledictorydoxycyclineexpedientlysteadfastlyunavoidablyindubitablyunabashedlydeliriouslycylindricalseductively
...View all with 11 letters...
Phrases (154)
body politicadmiral byrdlaugh loudlydry cleaningacrylic aciddwindle awaymemorial daybald cypressjohn tyndallnodal rhythm
...View all with 11 letters...
Words (684)
accidentallydeliberatelyindistinctlyunexpectedlyincidentallydramaticallyindefinitelydisciplinaryindividuallyconsiderablyencyclopediatremendouslydefinitivelybloodthirstyridiculouslyformaldehydeperiodicallytriglyceridedelightfullyadditionallydisgustinglyhydrothermalcrystallizedacademicallydomesticallydesirabilityconfoundedlyskullduggeryhydrochloricotherworldlymethodicallyinadequatelybodybuildingdisturbinglyadaptability
...View all with 12 letters...
Phrases (199)
mary magdalenscantily cladadmiral deweyread-only fileadmiralty lawfully fledgedmaterial bodydwight l. moodydevil-may-caredramatic play
...View all with 12 letters...
Words (530)
fundamentallyindependentlytraditionallydysfunctionalindividualityinadvertentlypredominantlyparadoxicallyideologicallyencyclopaediadissimilarityindifferentlydistressinglyhydroelectrichydrochloridedependabilityhydraulicallydimensionallypredominatelyhydrocephalusdisparaginglyadrenalectomyeducationallydistinctivelyendocrinologyincredulouslydiametricallyindescribablydisgracefullyexpeditiouslyunconcernedlyrhapsodicallypolydactylismdillydallyingquadrennially
...View all with 13 letters...
Phrases (249)
el iskandriyahfamily laridaeneglect of dutysecond balconyfamily picidaecustody battlearnold toynbeebattle of pydnaclyde tombaughadmiralty mile
...View all with 13 letters...
Words (382)
coincidentallywholeheartedlyunderstandablydemocraticallyconfidentiallypredictabilityclitoridectomyreproductivelydiscourteouslydimensionalitydiplomaticallyphosphorylatedinconsiderablyintermediatelydifferentiallyidealisticallyprovidentiallyorthopedicallydepartmentallydemythologiseddiagnosticallydirectionalitydisapprovinglydisconsolatelypreponderantlydisputatiouslyadvantageouslydemythologizeddisingenuouslyabsentmindedlyheavyheartedlydeliberativelydiscontentedlydepolymerizingconductibility
...View all with 14 letters...
Phrases (299)
field intensitylachrymal glandmoonseed familywilliam tyndaledimethyl ketonefamily ardeidaepituitary glanddrunken revelryveliky novgorodadmiralty brass
...View all with 14 letters...
Words (261)
confidentialityextraordinarilyunconditionallydisrespectfullylymphadenopathydevelopmentallycondescendinglyaerodynamicallycardiopulmonarydisappointinglymethylphenidatelackadaisicallydramaturgicallyuninterruptedlypolyunsaturateddemonstrativelyhypochondriacaldispassionatelycorrespondinglydemographicallyunprecedentedlyinconsideratelyperpendicularlyaccommodatinglydemonstrabilitysidesplittinglyreproducibilitybidirectionallyunadulteratedlypsychedelicallyhydromechanicalimponderabilitytenderheartedlypoliomyelitidespolysaccharides
...View all with 15 letters...
Phrases (371)
auditory ossiclecharlotte cordayclass pelecypodahelen wills moodydialysis machinefamily tinamidaemail-order buyingby trial and errorfamily leporidaefamily artamidae
...View all with 15 letters...
Words (85)
indiscriminatelyunpredictabilitydendrochronologypolydispersitiesdiscriminatorilyparadigmaticallyjurisdictionallyparaformaldehydespondylarthritisradiographicallyadministrativelyunconditionalitydimethylglyoximemonocotyledonousindiscernibilityleukodystrophiesperpendicularityindispensabilitylyginopteridalesdenominationallycyclophosphamideindefatigabilityautopolyploidiesstrongyloidiasesstrongyloidiasisdecarboxylationsdodecaphonicallyoligodendrocytesimmunomodulatoryhydroelectricityleptotyphlopidaebiodegradabilityindescribabilityundiplomaticallyadenohypophyseal
...View all with 16 letters...
Phrases (343)
hypodermic needleitalian greyhoundfamily cyprinidaecardiac glycosidepodocarpus familyalan lloyd hodgkinfamily locustidaedwight lyman moodycock-and-bull storyfamily balaenidae
...View all with 16 letters...
Words (58)
straightforwardlythermodynamicallymultidisciplinaryinterdisciplinaryself-contradictoryradiobiologicallycercidiphyllaceaeparaformaldehydeskaleidoscopicallyspondylolisthesisradioisotopicallyhypochondriacallyunderstandabilityidiosyncraticallydisrespectabilitylymphadenopathiestransdisciplinarycyclophosphamidesstrongyloidosisesthiodiphenylaminehydrofluorocarbondehydrochlorinasedehydrochlorinatetridimensionalityptilonorhynchidaeindestructibilityjurisprudentiallydisadvantageouslyturbidimetricallydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationsdiphenylhydantointwo-dimensionality
...View all with 17 letters...
Phrases (357)
lycopodium alpinummary mcleod bethuneclass rhodophyceaefamily dasypodidaecylinder separatorcylindrical liningfamily trochilidaefamily didelphidaecaesarian deliverycapital of maryland
...View all with 17 letters...
Words (35)
disproportionatelyhyperaldosteronismelectrodynamometerpolyribonucleotidecylindrical-stemmedlipopolysaccharidediethylmalonylureadiethylstilbestroldistinguishabilitymucopolysaccharidehydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologydemythologizationsmethylprednisolonedeoxyribonucleasespropagandisticallydephosphorylationshydroxychloroquinecholecystectomizedhydroelectricitieshydrometallurgicalsedimentologicallyhydrometallurgistscounterdeploymentshydrometeorologieschlamydomonadaceaehydrometeorologistindiscriminatinglydiethylcarbamazinedimethylhydrazinesdimethyltryptaminediphenylhydantoinsPhrases (288)
bombycilla cedrorunworldly possessionsfamily physeteridaedame sybil thorndikefreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondfamily trichechidaefamily desmidiaceae
...View all with 18 letters...
Words (30)
hydrochlorothiazidepolyribonucleotidesmucopolysaccharideslipopolysaccharidesdiethylstilbesterolindividualisticallydiethylstilboestrolpharmacodynamicallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineelectrodynamometersinterdepartmentallycontradistinctivelythird-dimensionalitythree-dimensionalitymethylprednisolonesdeoxyribonucleotideencephalomyelitideshydroxytetracyclinehydrometeorologicalhydrometeorologistsdiethylcarbamazinesdiethylstilbestrolstetramethyldiarsinedimethylnitrosaminedimethyltryptamineselectrocardiographymultidimensionalityPhrases (272)
building supply houseacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaecalycanthus floridusfamily polypodiaceaehydrobates pelagicusliquid body substance
...View all with 19 letters...
Words (13)
tetrahydrocannabinolradioimmunoassayablelipochondrodystrophyindistinguishabilitymagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesiodochlorhydroxyquindeoxyribonucleotidesencephalomyocarditishydrochlorothiazidesdimethylnitrosaminesPhrases (258)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedevelopmental anatomyclyde william tombaughfamily dermochelyidaedianthus caryophyllussuricata tetradactylafamily pseudococcidae
...View all with 20 letters...
Words (5)
mucopolysaccharidosisphosphoglyceraldehydedendrochronologicallypolyvinyl-formaldehydetetrahydrocannabinolsPhrases (149)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeptolemy ii philadelphusprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidae
...View all with 21 letters...
Words (3)
phosphoglyceraldehydesencephalomyocarditisesdihydroxyphenylalaninePhrases (136)
redevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (1)
hydrochlorofluorocarbonPhrases (106)
family threskiornithidaeposterior pituitary glandmeperidine hydrochloridecalycanthus occidentalisthryothorus ludovicianuscanyonlands national parkbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillata
...View all with 23 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (68)
subphylum cephalochordatamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromedistinguished flying crossalexandre emile jean yersinapocynum androsaemifoliumfluoxetine hydrocholoridealfred edward woodley mason
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (55)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidessir arthur stanley eddingtonlepidocybium flavobrunneumtympanuchus pallidicinctus
...View all with 25 letters...
Phrases (39)
brassica oleracea gongylodessubmandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionrhythm method of birth control
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (35)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugbaron lloyd webber of sydmontontopical prostaglandin eyedrop
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (20)
aleksandr feodorovich kerenskytriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (19)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonmiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonfrancisco jose de goya y lucientestheory of punctuated equilibrium
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidmucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsbasic point defense missile system
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
freedom from involuntary servitudedigital communications technologydiego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontovulation method of family planningvladimir vladimirovich mayakovskimary godwin wollstonecraft shelleyPhrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugtheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united states
...View all with 32 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
