Words Containing: L,Y
(In Any Order)
There are 22,779 words,
9,297 phrases and
7 abbr's with
L,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
frizzly | 7 | 31 | adjectiveadj | |||||
adjective satellite • (of hair) in small tight curls | ||||||||
fuzzily | 7 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
muzzily | 7 | 30 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
drizzly | 7 | 29 | adverb, adjectiveadv, adj | |||||
adjective satellite • wet with light rain | ||||||||
dizzily | 7 | 29 | adverb, adjectiveadv, adj | |||||
adverb • in a giddy light-headed manner | ||||||||
mizzly | 6 | 29 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
kolkozy | 7 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kolhozy | 7 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1054)
reallyalwaysfamilymyselflovelyplayedlawyersimplyflyingslowlyguiltyhardlyplentylonelynearlyplayerlatelysurelyeasilyyellowbarelymostlylikelypolicydeeplyvalleyfilthyhighlytaylorsupplysalarysymbolnicelymerelysafely
...View all with 6 letters...
Phrases (20)
by luckslip bylay offbar flyplay upwet flyonly ifbee flydry flyleg day
...View all with 6 letters...
Words (1628)
alreadyexactlyplayingfinallytotallyquicklyusuallyrealityclearlyhealthyholidayyellingqualityabilitylibraryquietlyfranklylaundrytypicalcrystalhappilyheavilyapologypenaltystanleyloyaltylibertycloselyshortlylotteryluckilybicyclejewelryhalfwaygallery
...View all with 7 letters...
Phrases (74)
sea lilyonly toocow lilyred clayegg yolkin stylebay leafbay lynxfly highfly open
...View all with 7 letters...
Words (2407)
yourselfactuallyprobablysuddenlymilitarypossiblyrecentlyhonestlyproperlyphysicaldirectlyfriendlynormallydeliveryentirelyterriblyslightlyemployeefacilityalmightyanalysisdaylightsecretlystrictlymentallybrooklynassemblysexuallyheavenlyjealousystronglyunlikelybetrayalsolitaryolympics
...View all with 8 letters...
Phrases (180)
natal daysmall fryfall awaytype slugold styledry cleanaltar boynell gywnvery wellbaby talk
...View all with 8 letters...
Words (2870)
seriouslycertainlyobviouslyperfectlycarefullybasicallyextremelyhollywoodliterallynaturallyhopefullypreciselybutterflycurrentlygenerallycelebritypublicitycorrectlyspeciallygraduallylifestylelegendaryinstantlyspecialtysincerelyregularlystrangelyvirtuallyparalyzedsexualityinitiallyartilleryyggdrasilillegallyprivately
...View all with 9 letters...
Phrases (304)
salary cutmanila baylake nyasaholy placehigh stylelaugh awayloya jirgalike crazypuppy lovebilly club
...View all with 9 letters...
Words (3093)
absolutelycompletelydefinitelyespeciallyapparentlypersonallyeventuallytechnologyincrediblyofficiallyconstantlyphilosophyphysicallyoriginallymotorcyclepreviouslyultimatelylaboratorypsychologyunemployedsupposedlydifficultythoroughlyemploymentscreenplayhystericalelementaryplaygroundpeacefullyexcellencyrelativelyfrequentlyrepeatedlyseparatelysolidarity
...View all with 10 letters...
Phrases (419)
canada lynxgenus lyguswoody allenmary leakeyfleur-de-lyswoody plantholy rollercygnus olorline of dutyfamily line
...View all with 10 letters...
Words (2924)
immediatelyelectricitypossibilitypersonalitypracticallydifferentlynecessarilytechnicallyfortunatelyimportantlyessentiallybeautifullydesperatelyemotionallytemporarilyundoubtedlyhospitalitypoliticallypreliminarypotentiallypermanentlycredibilityimmortalityvoluntarilycomfortablygeneticallyprobabilityeffectivelyfinanciallywonderfullyexclusivelyaccordinglyyellowstonecontinuallynationality
...View all with 11 letters...
Phrases (525)
genus lycosagrass familylaying claimcrown colonyhigh qualitylaying wastelouis leakeysilver berrybody politicelinor wylie
...View all with 11 letters...
Words (2664)
particularlyspecificallyaccidentallyoccasionallypsychologistdeliberatelysuccessfullyunemploymentincreasinglysurprisinglyindistinctlypennsylvaniacontinuouslyunexpectedlyincidentallyunbelievablyevolutionarydramaticallyindefinitelydisciplinaryrespectfullypassionatelysufficientlymysteriouslyhypocriticalspiritualityindividuallymunicipalityconsiderablygynecologistmiraculouslyencyclopediaconsistentlytremendouslyhypothetical
...View all with 12 letters...
Phrases (636)
chlorophyll amary magdalenmolly pitchergenus glycinevisual acuityscantily cladhorn of plentylickety splitwilliam wylercalvary cross
...View all with 12 letters...
Words (2117)
unfortunatelypsychologicalrevolutionaryapproximatelyautomaticallyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallyfundamentallysignificantlyindependentlyinstinctivelystatisticallyspontaneouslytraditionallydysfunctionalvulnerabilityunconsciouslyinterestinglyappropriatelyindividualitycomplimentaryimpossibilitypsychoanalystparliamentaryinadvertentlyfantasticallyprogressivelyhieroglyphicsphysiologicalsubstantiallygynaecologistrealistically
...View all with 13 letters...
Phrases (674)
aleatory musicel iskandriyahfamily laridaevaginal arteryneglect of dutysecond balconygilbert murraymyrobalan plumfamily picidaein a similar way
...View all with 13 letters...
Words (1452)
responsibilitysimultaneouslyprofessionallyscientificallyhypotheticallypsychoanalysissystematicallyintellectuallycoincidentallymetaphoricallywholeheartedlyaffectionatelyunderstandablyelectronicallysubconsciouslyaccountabilityuncontrollablydemocraticallyoverwhelminglysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallynanotechnologysustainabilityunquestionablyintentionalityinterplanetaryconfidentiallyunsuccessfullypathologicallyterritorialityelectrotherapyhyperventilate
...View all with 14 letters...
Phrases (795)
family apiaceaepearl mae baileyfield intensitylachrymal glandbattle of nasebymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaetubal pregnancy
...View all with 14 letters...
Words (995)
psychologicallyconfidentialityextraordinarilyinternationallyunconditionallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologyphysiologicallydisrespectfullyphilosophicallyheterosexualityconscientiouslychronologicallylymphadenopathysynergisticallyinaccessibilityincompatibilitycrystallizationdevelopmentallyoversimplifyingintellectualitysurreptitiouslyparentheticallypsychobiologistplenipotentiarycondescendinglysuppositionallymicroscopicallyaerodynamicallyproportionatelymaneuverability
...View all with 15 letters...
Phrases (848)
syringa vulgarisauditory ossiclebenefit of clergycharlotte cordayclass pelecypodaalimentary pasteasamiya languagehelen wills moodydialysis machineebony spleenwort
...View all with 15 letters...
Words (411)
enthusiasticallyindiscriminatelyirresponsibilityconstitutionallyincomprehensiblycatastrophicallytriphenylmethanehyperintelligentunpredictabilityhyperventilationpsychoanalyticalquintessentiallyphylogeneticallyimperceptibilityuncompromisinglypsychophysiologyjournalisticallynonrevolutionaryelectromyographycircumstantiallypharmaceuticallymonosyllabicallyerythroblastosisextemporaneouslyunapologeticallythermostaticallysurrealisticallypsychobiologicalincontrovertiblyelectrochemistrydendrochronologyphotographicallyunprofessionallyinconceivabilityparapsychologist
...View all with 16 letters...
Phrases (824)
hypodermic needlein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungarywilliam wycherleyin all probabilitycardiac glycoside
...View all with 16 letters...
Words (239)
straightforwardlyunconventionalitybacteriologicallyconstitutionalityanthropologicallyperchloroethylenematerialisticallyneurophysiologistelectrostaticallycontemporaneouslythermodynamicallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsycholinguisticsmultidisciplinaryprobabilisticallyinterdisciplinaryantirevolutionaryself-contradictoryradiobiologicallyisoelectronicallycercidiphyllaceaepolymorphonuclearunexchangeabilityparaformaldehydeskaleidoscopicallyspondylolisthesisradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilations
...View all with 17 letters...
Phrases (792)
gopherus polypemusmary leontyne pricesalvia leucophyllabalaena mysticetusproteolytic enzymelycopodium alpinummary mcleod bethunehypoglycemic agentpearly everlastingclass rhodophyceae
...View all with 17 letters...
Words (130)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilitypsychopharmacologypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalpolyesterificationspectrofluorometrymethyltestosteronepolymorphonuclearselectrodynamometerspectroheliographypolyribonucleotidemultifunctionalitynoncomprehensivelypathophysiologicalpentylenetetrazolscylindrical-stemmedlaryngopharyngitisperchloroethyleneslipopolysaccharidepostpsychoanalyticunconstitutionallylymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicaltransformationallycalymmatobacteriumstoichiometricallyautobiographically
...View all with 18 letters...
Phrases (697)
bombycilla cedrorunworldly possessionsbombycilla garrulusrevolutionary groupfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyperomyscus leucopusjohn orley allen tate
...View all with 18 letters...
Words (90)
hydrochlorothiazidepsychophysiologicalcinematographicallypolyesterificationsextralinguisticallypolyribonucleotidesotorhinolaryngologyextraterritorialityhypersusceptibilityhypolipoproteinemiaparthenogeneticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallydiethylstilbesterolindividualisticallydiethylstilboestrolbacteriochlorophyllpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyechoencephalographydehydrochlorinatingdehydrochlorinationphosphatidylcholineelectrodynamometersinterconvertibilityphosphoenolpyruvatechromoblastomycosisinterdepartmentallyelectromagnetically
...View all with 19 letters...
Phrases (576)
building supply housewater-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngefamily cynoglossidaeseventeen-year locustitalian monetary unitlatvian monetary unitmillimeter of mercury
...View all with 19 letters...
Words (49)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitiveradioimmunoassayablelipochondrodystrophycrystallographicallyindistinguishabilitylymphogranulomatosesimmunocytochemicallylymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyhistoincompatibilityiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditis
...View all with 20 letters...
Phrases (505)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridae
...View all with 20 letters...
Words (23)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologisthypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (345)
icelandic monetary unitelectrolytic condensernikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoides
...View all with 21 letters...
Words (12)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (284)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (5)
hydrochlorofluorocarboncarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (208)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandmeperidine hydrochlorideyellowstone national parkcalycanthus occidentalisthryothorus ludovicianusinterlocutory injunctioncanyonlands national parkbangladeshi monetary unit
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (131)
carnegie mellon universitylouis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromebrassica oleracea botrytisdistinguished flying crossalexandre emile jean yersin
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (102)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesmelanerpes erythrocephalus
...View all with 25 letters...
Phrases (71)
brassica oleracea gongylodessubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasia
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (60)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (46)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (31)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalani
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (30)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (18)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (19)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay