Words Containing: L,N,E,D
(In Any Order)
There are 9,638 words,
6,899 phrases and
0 abbr's with
L,N,E,D in.
Best Scoring Words With: L,N,E,D
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
nuzzled | 7 | 26 | verbv | |||||
verb • move or arrange oneself in a comfortable and cozy position • rub noses • dig out with the snout | ||||||||
donzels | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
jungled | 7 | 16 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
lynched | 7 | 16 | verbv | |||||
verb • kill without legal sanction | ||||||||
donzel | 6 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
jingled | 7 | 16 | verbv | |||||
noun • a metallic sound • a comic verse of irregular measure verb • make a sound typical of metallic objects | ||||||||
jangled | 7 | 16 | verb, adjectivev, adj | |||||
noun • a metallic sound verb • make a sound typical of metallic objects | ||||||||
adnexal | 7 | 15 | adjectiveadj | |||||
adjective • of or pertaining to adnexa | ||||||||
nakedly | 7 | 15 | adverbadv | |||||
adverb • in an exposed manner; without protection or defense • without clothing | ||||||||
flanked | 7 | 15 | verbv | |||||
noun • the side of military or naval formation • a subfigure consisting of a side of something • a cut from the fleshy part of an animal's side between the ribs and the leg • the side between ribs and hipbone verb • be located at the sides of something or somebody | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
lendWords (381)
learnedenglandplanneddealingleadingincludeleonardendlessplantedhandledirelandneedlesdeclinezealandblindedicelandindulgelendingmandelasnidelyslandertangledhandlerblenderkendallinfidelswindleslenderalignedplunderblunderblendedweldinginhaledmangled
...View all with 7 letters...
Phrases (11)
lie downblend intail endred linelodge inlet downal dentedwell onnew dealsand eel
...View all with 7 letters...
Words (793)
childrensuddenlyinvolvedbleedingfriendlytalentedincludedhomelandentitledsplendidcalendardeadlinecanceledleonardolemonadereynoldssecondlyconcludeheadlinebalancedunlockedmodelingchandlerinclinedanalyzedfieldingneedlessdelusiondealingsunsolvedcylinderwrinkledlavendermeddlingdeclined
...View all with 8 letters...
Phrases (52)
melt downline feeddry cleanin detailloose endclosed innew delhibandy legax handlelens hood
...View all with 8 letters...
Words (1246)
wonderfulknowledgealexandercancelledscoundrellandscapelegendaryidenticalmadeleineclevelandinstalledstrangledalongsideevidentlyunlimitedexplodingneglectedconcealedconcludedendlesslyleningradblindnesswastelandgreenlandimplantedunrelatedoutlanderdeclaringprolongedlandslidebloodlinemedallionmedicinaldismantleinaudible
...View all with 9 letters...
Phrases (113)
slide downline driveline judgebreed lineseed plantedible nutmop handlehoe handlelangue d'ocnew dealer
...View all with 9 letters...
Words (1466)
girlfrienddefinitelyincredibleincrediblycontrolleddisciplinedevelopingunemployedunderworldchallengedeliminatedcinderellawildernessadrenalineinfluencedmotherlanddemolitionwindshielddelusionalaccidentaldisneylanddelegationadolescentfatherlandlaunderingchandelieralexandriarebuildingdelinquentwonderlandinfidelitydependableborderlineindulgenceunderlying
...View all with 10 letters...
Phrases (209)
woody allenwild peanutgentle windline of dutyd. h. lawrencefield pansyedible beanedible cornlie dormantaniline dye
...View all with 10 letters...
Words (1443)
developmentdifferentlyswitzerlandfundamentalacknowledgeundoubtedlyeducationaldeclarationmanipulateddimensionalwonderfullyenlightenedthunderclapdisciplinedcredentialsdefenselessresidentialnetherlandsdangerouslyadolescencespringfieldthunderboltblindfoldedinfiltratedneanderthalcandlelightimplementedclandestinedeliveranceunfulfilledannihilatedknuckleheadilluminatedunavoidableunexplained
...View all with 11 letters...
Phrases (294)
film editingslide actionspace needlenatalie woodcrank handleline drawingfield lupinejane goodallcenter fieldalizarin red
...View all with 11 letters...
Words (1279)
accidentallyconfidentialpresidentialconsiderableunexpectedlycheerleadingincidentallyindefinitelyacknowledgedconsiderablyencyclopediatremendouslydefinitivelydisplacementundetectabledifferentialconsolidatedfundamentalsnewfoundlandunparalleledchildishnessuntranslatedcoincidentaldebilitatinguncontrolledcontemplateddepartmentalinadmissiblethunderclouddishonorablepersonalizeddeliberationbattlegroundidentifiableunchallenged
...View all with 12 letters...
Phrases (388)
old ironsidesarnold gesellmary magdalenold line statearnold palmerfaroe islandsgladstone baggilding metalread-only filetea-like drink
...View all with 12 letters...
Words (1013)
grandchildrenunpredictablefundamentallyindependentlyknowledgeableindispensablecongratulatedvaledictorianindescribableinadvertentlydisillusionedacknowledginguncomplicatedpredominantlydevelopmentalredevelopmentdishonourableundisciplinedunadulteratedindividualizemaladjustmentperpendiculardirectionlessencyclopaediaindefatigableindifferentlydistressinglynondisclosuredependabilitydimensionallypredominatelypreindustrialrattlebrainedadrenalectomyeducationally
...View all with 13 letters...
Phrases (561)
john masefieldoutside clinchpaul hindemithel iskandriyahchannel islandblood relationneglect of dutyfocal distancesecond balconyslide fastener
...View all with 13 letters...
Words (768)
understandableindestructiblefundamentalistcoincidentallyunderstandablyindustrializedunderdevelopedrevolutionizedtranscendentalschoolchildrenconfidentiallydisembowellingindecipherablefundamentalismacknowledgmentrevolutioniseddenominationalunidentifiableindividualizedbullheadednessdefibrillationdimensionalitydesalinizationeditorializingdemobilizationunacknowledgedunderqualifiedunaccomplishedridiculousnessunidirectionalnorthumberlandinconsiderableinconsiderablyvaletudinarianintermediately
...View all with 14 letters...
Phrases (571)
protein foldinglobe-finned fishseriola grandisgelatin dessertfield intensityaudubon warblernoachian delugemoonseed familywilliam tindalefrances willard
...View all with 14 letters...
Words (548)
confidentialityextraordinarilyacknowledgementunderprivilegeddisillusionmentlymphadenopathydevelopmentallydestabilizationcondescendinglydistinguishableaerodynamicallymethylphenidateomnidirectionaljurisprudentialuninterruptedlypolyunsaturateddemonstrativelylightheadednessdematerializingdispassionatelycorrespondinglyunprecedentedlyendocrinologistinconsideratelydefenselessnesscounterbalancedsentimentalizedperpendicularlydistastefulnesscomplicatednessdistrustfulnessdisgracefulnessdemonstrabilitycoldheartednesssidesplittingly
...View all with 15 letters...
Phrases (626)
panel discussioniridaceous plantitalian dressinghelen wills moodydialysis machinesingapore dollarfamily tinamidaedefinite articlenewton's third lawbelgian shepherd
...View all with 15 letters...
Words (236)
indiscriminatelyunderdevelopmentmultidimensionalunpredictabilitymultidirectionalintellectualizeddemineralizationdenaturalizationfundamentalisticdendrochronologylightheartednessdecentralizationcolorblindnesseslepidodendraceaedisdainfulnessesdisentanglementsdisequilibratingdisequilibrationadministrativelyself-depreciationbalaenicipitidaelandlubberlinessradiotelephoniesunprinciplednessmonocotyledonousdisillusionmentslargeheartednessdisconsolatenesspardonablenessespostdepositionalindiscernibilitycreditablenessesdisorderlinessesdispensabilitieswell-proportioned
...View all with 16 letters...
Phrases (573)
hypodermic needleczar alexander iiiitalian greyhoundold latin languagedelphinium ajacisbattle of omdurmanfamily cyprinidaehead cabbage plantbill of indictmentdefinite integral
...View all with 16 letters...
Words (142)
institutionalizedindistinguishabledepersonalizationtranscendentalisminstitutionalisedcompartmentalizedthermodynamicallytranscendentalistcompartmentalisedinterdisciplinarynondenominationaldematerializationinterdepartmentalknowledgeablenessself-contradictoryparadoxicalnesseselectrodepositionunmelodiousnessesspondylolisthesisdisequilibrationsdisestablishmentsdisgracefulnessesself-determinationicelandic-speakingsplendiferousnesslevelheadednessesunderstandabilityoutward-developingdenominationalismindispensablenesscomplicatednesseslongsightednessesmachine-controlleddisrespectfulnessdecriminalisation
...View all with 17 letters...
Phrases (577)
larix occidentalisdirect correlationlandscape gardenerlandscape paintingmary mcleod bethunehundred dollar billmiguel de cervantesorder oedogonialesaleksandr scriabininterstitial fluid
...View all with 17 letters...
Words (82)
disproportionatelyhyperaldosteronismelectrodynamometerpolyribonucleotideknowledgeabilitiesunpredictabilitiesdishonorablenesseslandlubberlinessesunprinciplednesseslargeheartednessesfeeblemindednessescylindrical-stemmedlightheartednessesmuddleheadednessesdisreputablenessestranscendentalismstranscendentalistscurmudgeonlinessesvaletudinarianismsperpendicularitiesdiethylmalonylureaverisimilitudinousdecriminalizationsmalcontentednessesconstitutionalizeddehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologyelectrodepositionselectrodesiccationpseudopleuronectesdeinstitutionalizeotherworldlinessesbloodthirstinesses
...View all with 18 letters...
Phrases (538)
hindu calendar monthbombycilla cedrorunworldly possessionsdame sybil thorndikeandromeda polifoliahindustani languagefreudian psychologycapital of indonesiaread-only memory chipsecond cranial nerve
...View all with 18 letters...
Words (52)
sternocleidomastoidpolyribonucleotidesknowledgeablenessessplendiferousnessesdisrespectfulnesseslanguedoc-roussillonmultitudinousnessesreindustrializationphenylthiocarbamidepseudohallucinationreinstitutionalizeddehydrochlorinatingdehydrochlorinationphosphatidylcholineelectrodesiccationstridimensionalitiesdeindustrializationelectrodynamometersdeinstitutionalizedinterdepartmentallydeinstitutionalizescontradistinctivelythird-dimensionalitythree-dimensionalityinterjurisdictionaldendrochronologicaldendrochronologistsmethylprednisolonesdeoxyribonucleotidereticuloendothelialdepartmentalizationencephalomyelitidesgood-neighbourlinesshydroxytetracyclineindefatigablenesses
...View all with 19 letters...
Phrases (460)
building supply houseaquilegia canadensissierra madre orientalfamily cynoglossidaelepidopterous insectread between the linespellaea rotundifoliahandle with kid glovessir noel pierce cowarddelusions of grandeur
...View all with 19 letters...
Words (25)
tetrahydrocannabinolparadichlorobenzenesradioimmunoassayabledistinguishabilitiesmagnetofluiddynamicsreindustrializationsphenylthiocarbamidesglomerulonephritidesneuroendocrinologiesneuroendocrinologistdehydrochlorinationsphosphatidylcholinesdeindustrializationsnoninstitutionalisednoninstitutionalizeddeinstitutionalizingdeoxyribonucleotidesdepartmentalizationsencephalomyocarditisinconsiderablenessespseudocholinesteraseoverintellectualizednondenominationalismindestructiblenessesdimethylnitrosaminesPhrases (383)
calendula officinalisscandinavian languageappendicular skeletondwarf flowering almondlunar excursion modulesir karl raimund popperdouble-reed instrumentdevelopmental anatomypierre simon de laplacealessandro cagliostro
...View all with 20 letters...
Words (11)
disestablishmentarianmultidimensionalitiesneuroendocrinologicalneuroendocrinologistsmeningoencephalitidesdendrochronologicallypolyvinyl-formaldehydepseudocholinesterasesnondenominationalismsindistinguishablenesstetrahydrocannabinolsPhrases (290)
sierra madre occidentalhead and shoulders abovedissolution of marriagedirect electric currentexperimental conditionicelandic monetary unitdiametrical oppositionelectrolytic condenseraleksandr solzhenitsynalan bartlett shepard jr.
...View all with 21 letters...
Words (5)
disestablishmentariansdeinstitutionalizationencephalomyocarditisesdihydroxyphenylalanineindistinguishabilitiesPhrases (266)
gregorian calendar monthadministrative officialredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaejohn ronald reuel tolkienfoeniculum vulgare dulceteacher-student relation
...View all with 22 letters...
Words (3)
deinstitutionalizationsdichlorodifluoromethaneindistinguishablenessesPhrases (184)
gilbert and ellice islandsfamily threskiornithidaesecond battle of el alameinposterior pituitary glandto all intents and purposesmeperidine hydrochlorideelectromechanical devicetweedledum and tweedledeecalycanthus occidentalispharmacological medicine
...View all with 23 letters...
Words (2)
phosphatidylethanolaminedichlorodifluoromethanesPhrases (158)
basque homeland and freedomlowland burrowing treefrogpelham grenville wodehousemary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromebattle of the spanish armadadistinguished flying crossadolf otto reinhold windaus
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (125)
count ferdinand von zeppelinembryonal rhabdomyosarcomacluster of differentiation 4miguel de cervantes saavedrafrancis scott key fitzgeraldbattle of the chemin-des-damescruel and unusual punishmentnational science foundationdistinguished service medalfriedrich wilhelm nietzsche
...View all with 25 letters...
Phrases (88)
channel islands national parkfrances eliza hodgson burnettx-linked dominant inheritancebacon-lettuce-tomato sandwichsir sarvepalli radhakrishnanbrassica oleracea gongylodespolicing and enforcement costalternanthera philoxeroidesmalignant neoplastic diseasejohn burdon sanderson haldane
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (67)
partial differential equationamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transducersolenostemon scutellarioidesnational labor relations boarddirector-stockholder relation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (54)
aleksandr feodorovich kerenskytriphosphopyridine nucleotideoxytetracycline hydrochloridecardiopulmonary resuscitationbattles of lexington and concordthird council of constantinoplecapital of serbia and montenegrodemocratic republic of the congocriminal investigation commandfederal housing administration
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (61)
second council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organcapital of the dominican republicsouth-central dravidian languagegiovanni pierluigi da palestrinacapital of the russian federation
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (36)
valentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsyndepartment of energy intelligencedouble standard of sexual behaviordepository financial institutionvicomte ferdinand marie de lessepsethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorov
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (35)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudedigital communications technologysidonie-gabrielle claudine colettesir john frederick william herschelfrances elizabeth caroline willardmanipulative electronic deceptionelectromotive drug administration
...View all with 31 letters...
Phrases (26)
nikolai andreyevich rimski-korsakovpeople against gangsterism and drugsdepartment of the federal governmentsergei aleksandrovich koussevitzkystraight-line method of depreciationobject-oriented programing languagecount nikolaus ludwig von zinzendorfnikolai andreyevich rimsky-korsakovnonsteroidal anti-inflammatory drugtheory of electrolytic dissociation
...View all with 32 letters...
Phrases (22)
linear-quadratic-gaussian controllermusical instrument digital interfacebreach of trust with fraudulent intentstandard generalized markup languagecongress of industrial organizationsobject-oriented programming languagemusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsmusculus obliquus externus abdominisnondepository financial institution
...View all with 33 letters...
Phrases (23)
relational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencesgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusmusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzvena centralis glandulae suprarenalis
...View all with 34 letters...
Phrases (16)
national baseball hall of fame and museumjohann christoph friedrich von schillerinternational development associationunited states postal inspection servicecomte donatien alphonse francois de sadecanadian security intelligence servicemaxmillien marie isidore de robespierrecockcroft and walton voltage multiplierimmigration and naturalization serviceanti-imperialist international brigade
...View all with 35 letters...
Phrases (14)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdychurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmentsecretary of health education and welfarecriminal intelligence services of canadatiberius claudius drusus nero germanicus
...View all with 36 letters...
Phrases (11)
sisters of the order of saint basil the greatunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusdemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankasecretary of housing and urban developmentdepartment of health education and welfarekarl friedrich hieronymus von munchhausen
...View all with 37 letters...
Phrases (11)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservenucleoside reverse transcriptase inhibitorfuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtz
...View all with 39 letters...
Phrases (8)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesnational archives and records administrationprayer of azariah and song of the three childrenrussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinotrillion floating point operations per second