Words Containing: L,I,F,E,R,I,N,G
(In Any Order)
There are 128 words,
489 phrases and
0 abbr's with
L,I,F,E,R,I,N,G in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
fertilizing | 11 | 24 | verb, noun, adjectivev, n, adj | |||||
verb • provide with fertilizers or add nutrients to • make fertile or productive • introduce semen into (a female) | ||||||||
flickering | 10 | 20 | adjectiveadj | |||||
adjective satellite • shining unsteadily | ||||||||
flichtering | 11 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
fingerlike | 10 | 18 | adjectiveadj | |||||
adjective satellite • resembling a finger | ||||||||
overfilling | 11 | 18 | verb, noun, adjectivev, n, adj | |||||
verb • To fill beyond capacity or beyond what is appropriate. | ||||||||
infrangible | 11 | 17 | adjectiveadj | |||||
adjective satellite • difficult or impossible to break or separate into parts • not capable of being violated or infringed | ||||||||
reinflaming | 11 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
fireballing | 11 | 17 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
filagreeing | 11 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
fingerlings | 11 | 16 | nounn | |||||
noun • a young or small fish | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (20)
springfieldfertilizingfertilisinginfrangibleoverfillingfilagreeingfingerlingsfiligreeingreinflaminggrainfieldsgirlfriendsfingernailsflichteringinterfilingrefilteringfireballingreinflatingpilferinglyfringillineforeliftingPhrases (5)
fire walkingreefing lineforeign billfiling clerkroofing tileWords (18)
electrifyingterrifyinglyfederalizingreliquefyingflickeringlypreflightingrequalifyinginterflowinginterfoldinglifeguardingreglorifyingfillagreeinggriseofulvinpowerliftingfringillidaediffrangibletriflingnessfederalisingPhrases (8)
little fingerfinger milletfelis tigrinaginger familysporting lifeclimbing fernfreight linerflying bridgeWords (20)
frighteninglyresolidifyingreclassifyingdesulfurizingoverinflatingfilibusteringproliferatingprequalifyingfiberglassingfortnightliesdeformalizinggriseofulvinsrefocillatingdesulfurisingdeformalisingpowerliftingsinterferinglylight-fingeredirrefrangibleirrefrangiblyPhrases (15)
surgical knifehenry fieldingfurnace liningflying reptileterrain flightlunatic fringehigh-angle fireengine failureplace of originclimbing frame
...View all with 13 letters...
Words (19)
defibrillatingfrangibilitiesoverfulfillingelectrofishingfieldstrippingrefrangibilityreflectorizinganguilliformesnimble-fingeredfilibusteringscentrifugalisecentrifugalizetriflingnessesinterfoliatingfingerspellingfringillaceousultrafilteringreflectorisingcircumflectingPhrases (20)
protein foldingbelgian griffoncapital of nigerinfernal regiongenus fringillastocking fillergenus trifoliumgesneria familyindigofera anilflowering onion
...View all with 14 letters...
Words (18)
oversimplifyingoverclassifyingoverfertilizingelectrofishingsspring-floweringinfrangiblenessoverfertilisingwinter-floweringoverflourishingunderfulfillinglife-threateningself-restrainingself-sacrificingcentrifugalisedcentrifugalisescentrifugalizedcentrifugalizesflatus-relievingPhrases (31)
line of reasoningfriedrich engelsright of electionfencing materialeugenia unifloramagnolia fraserifilago germanicafamily congridaemary ii of englandflowering quince
...View all with 15 letters...
Words (7)
infrangibilitiesrefrangibilitiesself-organisationself-organizationinterinfluencingself-aggrandisingself-aggrandizingPhrases (24)
definite integralcapital of nigeriafamily carangidaefringilla coelebsbelted kingfisherinstrument flyingfamily trogonidaerepublic of guineacalifornia nutmegdifferential gear
...View all with 16 letters...
Words (4)
ferrimagneticallyself-gratificationultracentrifugingprofessionalizingPhrases (32)
family engraulidaearticle of clothinglimanda ferrugineafamily graminaceaehenry vii of englandfalciform ligamentorganic fertiliserorganic fertilizergoldie's shield fernrejoicing of the law
...View all with 17 letters...
Words (1)
antiferromagneticallyPhrases (32)
dissolution of marriagematernal-infant bondingcapital of west virginiajohn greenleaf whittierbattle of granicus riverbattle of little bighornprofessional wrestlingtrip the light fantasticwinter flowering cherrymagnetic field strength
...View all with 21 letters...
Phrases (23)
professional organisationprofessional organizationtrip the light fantastic toebattle of the little bighorndistinguished flying crossgottfried wilhelm leibnitzcreating from raw materialsbiological warfare defenseoffice of inspector generalprimary colour for pigments
...View all with 24 letters...
Phrases (13)
francis scott key fitzgeraldreligious society of friendseigenvalue of a square matrixcharles frederick menningergreat plains of north americajacques etienne montgolfierbattle of pittsburgh landingcardiospermum grandiflorumgeneral theory of relativityfagus sylvatica atropunicea
...View all with 25 letters...
Phrases (15)
policing and enforcement costpersonal information managerbooker taliaferro washingtonrepublic of equatorial guineacalifornia single-leaf pinyonfinancial management serviceforce-feed lubricating systemself-registering thermometerfollicle-stimulating hormonebetty naomi goldstein friedan
...View all with 26 letters...
Phrases (10)
co-operative republic of guyanapositive reinforcing stimulusoffice of intelligence supporthypothalamic releasing factorrepublic of trinidad and tobagoadeline virginia stephen woolfequivalent-binary-digit factorarchaeological planning framemaurice hugh frederick wilkinsnegative reinforcing stimulusPhrases (10)
capital of serbia and montenegrodemocratic republic of the congofederal housing administrationsmall-for-gestational-age infantgates of the arctic national parkvena epigastrica superficialisfederal bureau of investigationbovine spongiform encephalitispan troglodytes schweinfurthiiliberation tigers of tamil eelamPhrases (9)
department of energy intelligencerepublic of bosnia and herzegovinaaugust friedrich leopold weismannsisters of st. michael the archangel1st viscount montgomery of alameinbachelor of science in engineeringfood and agriculture organizationferdinand victor eugene delacroixgestalt principle of organizationPhrases (9)
federal national mortgage associationfriedrich august kekule von stradonitzeuropean law enforcement organisationfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtzclostridium perfringens epsilon toxinfour-stroke internal-combustion engineforeign intelligence surveillance acteinstein's general theory of relativityPhrases (1)
general certificate of secondary education