Words Containing: L,E,Y,D
(In Any Order)
There are 3,388 words,
3,136 phrases and
0 abbr's with
L,E,Y,D in.
Best Scoring Words With: L,E,Y,D
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| mazedly | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
| vexedly | 7 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| dazedly | 7 | 21 | adverbadv | |||||
adverb • in a daze; in a dazed manner | ||||||||
| dialyze | 7 | 20 | verbv | |||||
verb • separate by dialysis | ||||||||
| mixedly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| jadedly | 7 | 19 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| lynched | 7 | 16 | verbv | |||||
verb • kill without legal sanction | ||||||||
| mildewy | 7 | 16 | adjectiveadj | |||||
adjective • Of, pertaining to, or affected with mildew | ||||||||
| cowedly | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yeldWords (113)
alreadydelayedelderlybradleyorderlysnidelyreadilyideallydeathlylayeredweirdlydenselyyodeledmyeloidcondylecrudelyyodelernakedlydiddleydevilryfixedlydialyzetiredlyallayedtyndalealloyedtepidlyadeptlysplayedyclepednotedlyendplaymedleysseedilyreedily
...View all with 7 letters...
Phrases (7)
red clayslide bydry cellwild ryeyield upglide byleap dayWords (270)
suddenlydirectlyfriendlydeliveryemployedreynoldssecondlyideologyadulteryanalyzedcylinderdelicacyfidelitysteadilydecentlytenderlyyodelingdyslexicwalleyedyieldinganalyseddimethylmodestlyladylikedivinelynewlywedyuletidewickedlydyslexiamediallycrediblydevoutlyshrewdlybenadrylstylized
...View all with 8 letters...
Phrases (20)
old styledry cleanegg yieldbandy leglive bodycd playerdelta rayold moneymale bodydevil ray
...View all with 8 letters...
Words (368)
legendaryparalyzedevidentlyendlesslyallegedlydisplayedparalysedmedicallyexcitedlyhurriedlydecidedlyroundelaycotyledonfederallydrunkenlyhideouslytediouslyassuredlyadverselyglycosidecredulitydefiantlyreputedlysoldierlydevotedlypointedlybellybandchandleryprudentlyadvisedlysalesladyindeliblyyodellingdamselflyunderplay
...View all with 9 letters...
Phrases (38)
tumble drylow comedylegal dutymilk yieldfred hoyleold baileybody louseearly birdearly daysholy order
...View all with 9 letters...
Words (448)
definitelyincrediblyunemployedsupposedlyrepeatedlydisneylandinfidelityunderlyingdiscreetlydeploymentindirectlysleepyheaddisorderlyreportedlyunfriendlyadmittedlyneedlesslyhandsomelydreadfullydelicatelyadequatelydiligentlysymbolizedunderbellymoderatelysplendidlyundeniablyunyieldingdiscretelydecisivelyindecentlydistillerymolybdenumyellowbirdepicondyle
...View all with 10 letters...
Phrases (75)
woody allenfleur-de-lysline of dutyfield pansyaniline dyelead astraypineal bodyblind alleyleydig celllady killer
...View all with 10 letters...
Words (487)
immediatelydifferentlydesperatelyundoubtedlycredibilitywonderfullydangerouslyexceedinglypsychedelicdelinquencyconfidentlypterodactylmethodologymoneylenderdeliverymandeliciouslydeceitfullyskulduggerydeceptivelycontentedlydefensivelybodybuilderpredictablyvaledictorydoxycyclineexpedientlysteadfastlyunabashedlydeliriouslyseductivelypsychedeliadishonestlyincredulitymelodicallydeservingly
...View all with 11 letters...
Phrases (96)
dry cleaningdwindle awaymemorial daybald cypressledger entrybilly the kidbilly wilderold world yewboulder clayalkyl halide
...View all with 11 letters...
Words (502)
accidentallydeliberatelyunexpectedlyincidentallyindefinitelyconsiderablyencyclopediatremendouslydefinitivelyformaldehydeperiodicallytriglyceridedelightfullyhydrothermalcrystallizedacademicallydomesticallydesirabilityconfoundedlyskullduggeryotherworldlymethodicallyinadequatelypolicyholderbegrudginglythunderouslygobbledygookunreservedlycoincidentlyevidentiallydemonstrablymealymouthedepidemiologydepressinglydespairingly
...View all with 12 letters...
Phrases (132)
mary magdalenadmiral deweyread-only filefully fledgedmaterial bodydevil-may-carefamily boidaejail deliveryedmond halleyfolding money
...View all with 12 letters...
Words (402)
fundamentallyindependentlyinadvertentlypredominantlyideologicallyencyclopaediaindifferentlydistressinglyhydroelectrichydrochloridedependabilitydimensionallypredominatelyhydrocephalusadrenalectomyeducationallydistinctivelyendocrinologyincredulouslydiametricallyindescribablydisgracefullyexpeditiouslyunconcernedlyquadrenniallyhydrosulphideuninhibitedlyendolymphaticconsideratelyunqualifiedlydeferentiallyhydrocephalicencyclopaedicembarrassedlyunpredictably
...View all with 13 letters...
Phrases (203)
el iskandriyahfamily laridaeneglect of dutysecond balconyfamily picidaecustody battlearnold toynbeebattle of pydnaclyde tombaughadmiralty mile
...View all with 13 letters...
Words (294)
coincidentallywholeheartedlyunderstandablydemocraticallyconfidentiallypredictabilityclitoridectomyreproductivelydiscourteouslydimensionalityphosphorylatedinconsiderablyintermediatelydifferentiallyidealisticallyprovidentiallyorthopedicallydepartmentallydemythologiseddirectionalitydisconsolatelypreponderantlyadvantageouslydemythologizeddisingenuouslyabsentmindedlyheavyheartedlydeliberativelydiscontentedlydepolymerizingdenumerabilityindestructiblylightheartedlygeohydrologistpolybutadienes
...View all with 14 letters...
Phrases (244)
field intensitymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaedrunken revelryveliky novgorodadmiralty metalpolymeric amidefamily turdidae
...View all with 14 letters...
Words (214)
confidentialityextraordinarilydisrespectfullylymphadenopathydevelopmentallycondescendinglyaerodynamicallymethylphenidateuninterruptedlypolyunsaturateddemonstrativelydispassionatelycorrespondinglydemographicallyunprecedentedlyinconsideratelyperpendicularlydemonstrabilitysidesplittinglyreproducibilitybidirectionallyunadulteratedlypsychedelicallyhydromechanicalimponderabilitytenderheartedlypoliomyelitidespolysaccharidesserendipitouslydisenchantinglydishearteninglyautotetraploidyhyperstimulatedhydroxylapatitesophisticatedly
...View all with 15 letters...
Phrases (327)
auditory ossiclecharlotte cordayclass pelecypodahelen wills moodydialysis machinefamily tinamidaemail-order buyingby trial and errorfamily leporidaefamily artamidae
...View all with 15 letters...
Words (69)
indiscriminatelyunpredictabilitydendrochronologypolydispersitiesparaformaldehydeadministrativelydimethylglyoximemonocotyledonousindiscernibilityleukodystrophiesperpendicularityindispensabilitylyginopteridalesdenominationallycyclophosphamideindefatigabilityautopolyploidiesstrongyloidiasesdecarboxylationsdodecaphonicallyoligodendrocyteshydroelectricityleptotyphlopidaebiodegradabilityindescribabilityadenohypophysealadenohypophysialelectrohydraulicinterdependentlyhyperlipoidaemiaallopolyploidiesmethylphenidatesphyllostomatidaehendecasyllabicshendecasyllables
...View all with 16 letters...
Phrases (292)
hypodermic needleitalian greyhoundfamily cyprinidaecardiac glycosidefamily locustidaefamily balaenidaeexemplary damageslaundry stiffenerfamily elateridaefamily blenniidae
...View all with 16 letters...
Words (47)
thermodynamicallyinterdisciplinaryself-contradictorycercidiphyllaceaeparaformaldehydeskaleidoscopicallyspondylolisthesisunderstandabilitydisrespectabilitylymphadenopathiescyclophosphamidesstrongyloidosisesthiodiphenylaminedehydrochlorinasedehydrochlorinatetridimensionalityptilonorhynchidaeindestructibilityjurisprudentiallydisadvantageouslyturbidimetricallydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationsdiphenylhydantointwo-dimensionalityphotoperiodicallyone-dimensionalityirreproducibilitydeterministicallyuncomprehendinglyepidemiologicallyhydroelectricallyhydrometallurgies
...View all with 17 letters...
Phrases (314)
mary mcleod bethuneclass rhodophyceaefamily dasypodidaecylinder separatorfamily trochilidaefamily didelphidaecaesarian deliveryfamily droseraceaedisorderly conducthexadecimal system
...View all with 17 letters...
Words (32)
disproportionatelyhyperaldosteronismelectrodynamometerpolyribonucleotidecylindrical-stemmedlipopolysaccharidediethylmalonylureadiethylstilbestrolmucopolysaccharidehydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologydemythologizationsmethylprednisolonedeoxyribonucleasesdephosphorylationshydroxychloroquinecholecystectomizedhydroelectricitieshydrometallurgicalsedimentologicallyhydrometallurgistscounterdeploymentshydrometeorologieschlamydomonadaceaehydrometeorologistdiethylcarbamazinedimethylhydrazinesdimethyltryptaminediphenylhydantoinsPhrases (260)
bombycilla cedrorunworldly possessionsfamily physeteridaedame sybil thorndikefreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondfamily trichechidaefamily desmidiaceae
...View all with 18 letters...
Words (28)
hydrochlorothiazidepolyribonucleotidesmucopolysaccharideslipopolysaccharidesdiethylstilbesteroldiethylstilboestrolphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineelectrodynamometersinterdepartmentallycontradistinctivelythird-dimensionalitythree-dimensionalitymethylprednisolonesdeoxyribonucleotideencephalomyelitideshydroxytetracyclinehydrometeorologicalhydrometeorologistsdiethylcarbamazinesdiethylstilbestrolstetramethyldiarsinedimethylnitrosaminedimethyltryptamineselectrocardiographymultidimensionalityPhrases (246)
building supply houseacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaefamily polypodiaceaehydrobates pelagicusliquid body substancesubfamily perdicidae
...View all with 19 letters...
Words (10)
tetrahydrocannabinolradioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesdeoxyribonucleotidesencephalomyocarditishydrochlorothiazidesdimethylnitrosaminesPhrases (230)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedevelopmental anatomyclyde william tombaughfamily dermochelyidaesuricata tetradactylafamily pseudococcidaeambystomid salamander
...View all with 20 letters...
Words (4)
phosphoglyceraldehydedendrochronologicallypolyvinyl-formaldehydetetrahydrocannabinolsPhrases (129)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeptolemy ii philadelphusprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidae
...View all with 21 letters...
Words (3)
phosphoglyceraldehydesencephalomyocarditisesdihydroxyphenylalaninePhrases (126)
redevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (62)
subphylum cephalochordatamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromedistinguished flying crossalexandre emile jean yersinapocynum androsaemifoliumfluoxetine hydrocholoridealfred edward woodley mason
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (52)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidessir arthur stanley eddingtonlepidocybium flavobrunneumreticuloendothelial system
...View all with 25 letters...
Phrases (36)
brassica oleracea gongylodescharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionrhythm method of birth controlhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (33)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugbaron lloyd webber of sydmontontopical prostaglandin eyedrop
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (20)
aleksandr feodorovich kerenskytriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (19)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonmiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonfrancisco jose de goya y lucientestheory of punctuated equilibrium
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidmucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsbasic point defense missile system
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
freedom from involuntary servitudedigital communications technologydiego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontovulation method of family planningmary godwin wollstonecraft shelleyPhrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugtheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united states
...View all with 32 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
