Words Containing: I,L,Y
(In Any Order)
There are 14,386 words,
6,794 phrases and
1 abbr with
I,L,Y in.
Best Scoring Words With: I,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
frizzly | 7 | 31 | adjectiveadj | |||||
adjective satellite • (of hair) in small tight curls | ||||||||
fuzzily | 7 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
muzzily | 7 | 30 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
drizzly | 7 | 29 | adverb, adjectiveadv, adj | |||||
adjective satellite • wet with light rain | ||||||||
dizzily | 7 | 29 | adverb, adjectiveadv, adj | |||||
adverb • in a giddy light-headed manner | ||||||||
mizzly | 6 | 29 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
quickly | 7 | 25 | adverbadv | |||||
adverb • with speed • with little or no delay • without taking pains | ||||||||
cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (723)
playingfinallyquicklyrealityholidayyellingqualityabilitylibraryquietlytypicalhappilyheavilylibertyluckilybicycledisplayrailwayrapidlybiologylightlyolympiclindsaytightlybrieflyqualifyfirstlycynicalclarifyclaritystylishgrizzlyhillarysnidelyalimony
...View all with 7 letters...
Phrases (22)
sea lilycow lilyin stylefly highday lilyslide byholy oilwild ryedry kilndry milk
...View all with 7 letters...
Words (1167)
militarypossiblyphysicaldirectlyfriendlydeliveryentirelyterriblyslightlyfacilityalmightyanalysisdaylightstrictlyunlikelysolitaryolympicsslipperymoralitysilentlyapplyingpubliclyliterarysymbolicmultiplymysticalbullyingideologyhorriblymalaysiapolitelysociallyimplyingsyphilisequality
...View all with 8 letters...
Phrases (60)
egg yieldlive bodypay claimiron ladyeye blinkfile awaymilk wheypond lilyplay listlaying on
...View all with 8 letters...
Words (1583)
seriouslycertainlyobviouslybasicallyliterallypreciselycelebritypublicityspeciallylifestyleinstantlyspecialtysincerelyvirtuallysexualityinitiallyartilleryyggdrasilillegallyprivatelyevidentlytypicallyliabilityamazinglyformalitywillinglymentalitygenuinelyseeminglystabilitybrutalityhairstylefertilityprimarilyviolently
...View all with 9 letters...
Phrases (116)
manila bayhigh styleloya jirgalike crazybilly clubfamily manegg layingalloy ironbenny hillhair style
...View all with 9 letters...
Words (1899)
definitelyespeciallyincrediblyofficiallyphilosophyphysicallyoriginallypreviouslyultimatelydifficultyhystericalrelativelysolidaritypositivelydisneylandpopularitydisabilitytragicallyinevitablysimplicityyugoslaviaironicallyspecialitycomplexityinfidelityvisibilitycapabilityunderlyingdiscreetlyfaithfullyrelativityinfinitelyrightfullyinternallysimilarity
...View all with 10 letters...
Phrases (185)
line of dutyfamily linemt. mckinleyfield pansyrift valleyaniline dyeyemeni rialrailway carfamily unitdry walling
...View all with 10 letters...
Words (2013)
immediatelyelectricitypossibilitypersonalitypracticallydifferentlynecessarilytechnicallyimportantlyessentiallybeautifullyemotionallytemporarilyhospitalitypoliticallypreliminarypotentiallycredibilityimmortalityvoluntarilygeneticallyprobabilityeffectivelyfinanciallyexclusivelyaccordinglycontinuallynationalitymomentarilycalligraphyflexibilityspirituallytranquilityconsciouslybrilliantly
...View all with 11 letters...
Phrases (285)
grass familylaying claimhigh qualitylaying wastelouis leakeysilver berrybody politicelinor wyliebulb syringesonny liston
...View all with 11 letters...
Words (1947)
particularlyspecificallyaccidentallyoccasionallypsychologistdeliberatelyincreasinglysurprisinglyindistinctlypennsylvaniacontinuouslyincidentallyunbelievablyevolutionarydramaticallyindefinitelydisciplinarypassionatelysufficientlymysteriouslyhypocriticalspiritualityindividuallymunicipalityconsiderablygynecologistmiraculouslyencyclopediaconsistentlyhypotheticalhistoricallyaggressivelyeconomicallyinvisibilitydefinitively
...View all with 12 letters...
Phrases (378)
molly pitchergenus glycinevisual acuityscantily cladlickety splitwilliam wyleradmiral deweyread-only filehockey clinicshaking palsy
...View all with 12 letters...
Words (1730)
psychologicalrevolutionaryapproximatelyautomaticallyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallysignificantlyindependentlyinstinctivelystatisticallytraditionallydysfunctionalvulnerabilityunconsciouslyinterestinglyappropriatelyindividualitycomplimentaryimpossibilityparliamentaryinadvertentlyfantasticallyprogressivelyhieroglyphicsphysiologicalsubstantiallygynaecologistrealisticallycompatibilitystrategicallypredominantlyexponentially
...View all with 13 letters...
Phrases (428)
aleatory musicel iskandriyahfamily laridaevaginal arterygilbert murrayfamily picidaein a similar waymount mckinleymyrsine familyadmiralty mile
...View all with 13 letters...
Words (1218)
responsibilitysimultaneouslyprofessionallyscientificallyhypotheticallypsychoanalysissystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallysubconsciouslyaccountabilitydemocraticallyoverwhelminglysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallysustainabilityunquestionablyintentionalityinterplanetaryconfidentiallypathologicallyterritorialityhyperventilateproportionallynitroglycerineexcruciatinglyintermittentlyconservativelypsychoanalytic
...View all with 14 letters...
Phrases (559)
family apiaceaepearl mae baileyfield intensitymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaepituitary glandhigh technologyveliky novgorod
...View all with 14 letters...
Words (869)
psychologicallyconfidentialityextraordinarilyinternationallyunconditionallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologyphysiologicallydisrespectfullyphilosophicallyheterosexualityconscientiouslychronologicallysynergisticallyinaccessibilityincompatibilitycrystallizationoversimplifyingintellectualitysurreptitiouslyparentheticallypsychobiologistplenipotentiarycondescendinglysuppositionallymicroscopicallyaerodynamicallyproportionatelymaneuverabilitycardiopulmonarytherapeutically
...View all with 15 letters...
Phrases (670)
syringa vulgarisauditory ossiclebenefit of clergyalimentary pasteasamiya languagehelen wills moodydialysis machinefamily tinamidaefamily lemnaceaefamily arecaceae
...View all with 15 letters...
Words (358)
enthusiasticallyindiscriminatelyirresponsibilityconstitutionallyincomprehensiblycatastrophicallytriphenylmethanehyperintelligentunpredictabilityhyperventilationpsychoanalyticalquintessentiallyphylogeneticallyimperceptibilityuncompromisinglypsychophysiologyjournalisticallynonrevolutionarycircumstantiallypharmaceuticallymonosyllabicallyerythroblastosisunapologeticallythermostaticallysurrealisticallypsychobiologicalincontrovertiblyelectrochemistryphotographicallyunprofessionallyinconceivabilityparapsychologistconversationallyincorruptibilitypolydispersities
...View all with 16 letters...
Phrases (631)
hypodermic needlein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungarywilliam wycherleyin all probabilitycardiac glycoside
...View all with 16 letters...
Words (214)
straightforwardlyunconventionalitybacteriologicallyconstitutionalityanthropologicallymaterialisticallyneurophysiologistelectrostaticallythermodynamicallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsycholinguisticsmultidisciplinaryprobabilisticallyinterdisciplinaryantirevolutionaryself-contradictoryradiobiologicallyisoelectronicallycercidiphyllaceaeunexchangeabilitykaleidoscopicallyspondylolisthesisradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallymonochromaticallyrationalisticallyhypnotizabilities
...View all with 17 letters...
Phrases (633)
mary leontyne pricesalvia leucophyllabalaena mysticetusproteolytic enzymelycopodium alpinumhypoglycemic agentpearly everlastingfamily dasypodidaelycopus americanussubphylum craniata
...View all with 17 letters...
Words (113)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalpolyesterificationspectroheliographypolyribonucleotidemultifunctionalitynoncomprehensivelypathophysiologicalcylindrical-stemmedlaryngopharyngitislipopolysaccharidepostpsychoanalyticunconstitutionallylymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicaltransformationallycalymmatobacteriumstoichiometricallyautobiographicallydiethylmalonylurearecrystallizationsdiethylstilbestroldistinguishabilitycounterintuitivelymucopolysaccharidehypercholesteremia
...View all with 18 letters...
Phrases (567)
bombycilla cedrorunworldly possessionsbombycilla garrulusrevolutionary groupfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologynavigational systempodilymbus podiceps
...View all with 18 letters...
Words (84)
hydrochlorothiazidepsychophysiologicalcinematographicallypolyesterificationsextralinguisticallypolyribonucleotidesotorhinolaryngologyextraterritorialityhypersusceptibilityhypolipoproteinemiaparthenogeneticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallydiethylstilbesterolindividualisticallydiethylstilboestrolbacteriochlorophyllpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholineinterconvertibilitychromoblastomycosisinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionality
...View all with 19 letters...
Phrases (516)
building supply housewater-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngefamily cynoglossidaeitalian monetary unitlatvian monetary unitmillimeter of mercuryalpine type of glacier
...View all with 19 letters...
Words (46)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitiveradioimmunoassayablelipochondrodystrophycrystallographicallyindistinguishabilityimmunocytochemicallylymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyhistoincompatibilityiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylation
...View all with 20 letters...
Phrases (435)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaeoryctolagus cuniculus
...View all with 20 letters...
Words (21)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologisthypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (312)
icelandic monetary unitelectrolytic condensernikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoides
...View all with 21 letters...
Words (8)
spectrophotometricallyintercomprehensibilityotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (264)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (185)
family threskiornithidaeposterior pituitary glandmeperidine hydrochlorideyellowstone national parkcalycanthus occidentalisthryothorus ludovicianusinterlocutory injunctioncanyonlands national parkbangladeshi monetary unitdorothy rothschild parker
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (118)
carnegie mellon universitylouis seymour bazett leakeymary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromebrassica oleracea botrytisdistinguished flying crossalexandre emile jean yersinapocynum androsaemifolium
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (89)
myroxylon balsamum pereiraefrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline system
...View all with 25 letters...
Phrases (65)
brassica oleracea gongylodessubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasia
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (55)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drug
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (45)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (30)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (29)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (18)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay