Words Containing: I,L,S,Y
(In Any Order)
There are 6,769 words,
3,504 phrases and
0 abbr's with
I,L,S,Y in.
Best Scoring Words With: I,L,S,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| sizably | 7 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| sixthly | 7 | 20 | adverbadv | |||||
adverb • in the sixth place | ||||||||
| stylize | 7 | 19 | verbv | |||||
verb • represent according to a conventional style | ||||||||
| zestily | 7 | 19 | adverb, adjectiveadv, adj | |||||
adverb • with zest | ||||||||
| kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
| skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| shakily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in an insecurely shaky manner • in a manner characterized by trembling or shaking | ||||||||
| sylphic | 7 | 17 | adjectiveadj | |||||
adjective satellite • (of a woman or girl) slender and graceful like a sylph | ||||||||
| huskily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a hoarse or husky voice | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
syliWords (220)
displaylindsayfirstlystylishsnidelyswiftlystyliststylingslayingcyclistsaintlyskylinehastilysilveryyisraelfalsityelysiansolidlyfalsifymiserlynoisilypaisleyspindlybristlyelysiumvisiblyshakilybrisklystifflysoymilkslipwaysnifflygristlyshrillypiously
...View all with 7 letters...
Phrases (4)
sea lilyin styleslide byst. cyrilWords (469)
possiblyphysicalslightlyanalysisstrictlysolitaryolympicsslipperysilentlysymbolicmysticalmalaysiasociallysyphilisepilepsysteadilyskylightdialysisvisuallyinsanelyladyshipdisloyalladyfishsimplifystupidlyclassifylobbyistpriestlydyslexicdistallysensiblylyricistsquigglysenilitysolidify
...View all with 8 letters...
Phrases (13)
play listyak's milkstink flyslip awaysego lilywill hayslily ponssilky elmsilky oaksnow lily
...View all with 8 letters...
Words (696)
seriouslyobviouslybasicallypreciselyspeciallylifestyleinstantlyspecialtysincerelysexualityyggdrasilseeminglystabilityhairstylejellyfishhimalayasparalysisdisplayedhostilityintenselyimmenselysimilarlysmilinglysupplyingsociologysymbolismanxiouslymiserablymusicallydaylightsaimlesslymalaysiancuriouslyfoolishlymassively
...View all with 9 letters...
Phrases (22)
high stylehair stylelife storywild pansyswamp lilylittle yussailor boyemily postwiley postwill h. hays
...View all with 9 letters...
Words (842)
especiallyphilosophyphysicallypreviouslyhystericalsolidaritypositivelydisneylanddisabilitysimplicityyugoslaviaspecialityvisibilitydiscreetlysimilaritydistinctlyhydraulicssensualityphysiologydisorderlyvigorouslymistakenlygraciouslystealthilysurgicallyshockinglytirelesslycautiouslyskillfullycosmicallysymbolizeddisloyaltydisqualifysplendidlyscathingly
...View all with 10 letters...
Phrases (58)
field pansyisle of skyespanish flylist systemeaster lilyfloppy diskbasil thymecity limitssafety isleplay tricks
...View all with 10 letters...
Words (959)
possibilitypersonalitynecessarilyessentiallyhospitalityexclusivelyspirituallyconsciouslysymmetricalmercilesslydrasticallyinstabilityexcessivelypsychedelicmasculinitycataclysmicunanimouslysensibilityuniversallysingularityincessantlynotoriouslyextensivelyreligiouslyresponsiblyvicariouslyfashionablyobsessivelypyroclasticexquisitelycrystallineimpulsivelysymbolizingselectivelyferociously
...View all with 11 letters...
Phrases (92)
grass familylaying wastelouis leakeysilver berrybulb syringesonny listonsingle entryspecial jurypussy willowbicycle seat
...View all with 11 letters...
Words (965)
specificallyoccasionallypsychologistincreasinglysurprisinglyindistinctlypennsylvaniacontinuouslydisciplinarypassionatelysufficientlymysteriouslyspiritualityconsiderablygynecologistmiraculouslyconsistentlyhistoricallyaggressivelyinvisibilitybloodthirstyridiculouslymetaphysicalstorytellinghystericallytransylvaniasuspiciouslymeticulouslysymbolicallyartisticallyconclusivelydisgustinglycrystallizedasymmetricalrespectively
...View all with 12 letters...
Phrases (141)
genus glycinevisual acuityscantily cladlickety splitshaking palsysquirrel awayphantasy lifeacrylic resincost analysistreasury bill
...View all with 12 letters...
Words (881)
psychologicalunnecessarilyhomosexualitysignificantlyinstinctivelystatisticallydysfunctionalunconsciouslyinterestinglyimpossibilityfantasticallyprogressivelyhieroglyphicsphysiologicalsubstantiallygynaecologistrealisticallystrategicallysarcasticallyastonishinglyeverlastinglystereotypicalconsecutivelypainstakinglyirresponsiblysuperficiallyaestheticallyconspicuouslydissimilarityintravenouslydistressinglycholecystitissensationallyneurosyphilissymmetrically
...View all with 13 letters...
Phrases (196)
aleatory musicel iskandriyahin a similar waymyrsine familycooley's anemiaacrylate resincost of qualitycanary islandssalivary glandsolidarity tax
...View all with 13 letters...
Words (670)
responsibilitysimultaneouslyprofessionallyscientificallypsychoanalysissystematicallysubconsciouslysentimentalityrespectabilitysustainabilityunquestionablyconservativelypsychoanalyticsusceptibilitysatisfactorilyembarrassinglylinguisticallymetaphysicallysociologicallyscholasticallydiscourteouslydimensionalityinsufficientlyconstructivelyoptimisticallyastronomicallysuperficialityinconsiderablysimplisticallyidealisticallyaltruisticallypyelonephritisostentatiouslydemythologiseddiagnostically
...View all with 14 letters...
Phrases (237)
field intensitymoonseed familyyellowish brownsabbatical yearadmiralty brassmaxillary sinusvisual propertybusman's holidaycarya laciniosacooley's anaemia
...View all with 14 letters...
Words (486)
psychologicallyinstantaneouslyanaesthesiologyphysiologicallydisrespectfullyphilosophicallyheterosexualityconscientiouslysynergisticallyinaccessibilitycrystallizationoversimplifyingsurreptitiouslypsychobiologistcondescendinglysuppositionallymicroscopicallydisappointinglyinfinitesimallyinstrumentalitycontroversiallyinconspicuouslysuccinylcholineneurophysiologycytomegaloviruscompassionatelyrecrystallizinglackadaisicallypostoperativelyintrospectivelydemonstrativelyirresistibilityinspirationallygastronomicallyunquestioningly
...View all with 15 letters...
Phrases (294)
syringa vulgarisauditory ossiclealimentary pasteasamiya languagehelen wills moodydialysis machinegenus sylvilaguspsychotic beliefgenus bombycillaadmiralty island
...View all with 15 letters...
Words (195)
enthusiasticallyindiscriminatelyirresponsibilityconstitutionallyincomprehensiblycatastrophicallypsychoanalyticalquintessentiallyuncompromisinglypsychophysiologyjournalisticallycircumstantiallymonosyllabicallyerythroblastosisthermostaticallysurrealisticallypsychobiologicalelectrochemistryunprofessionallyparapsychologistconversationallypolydispersitiesdiscriminatorilyhypersalivationsinextinguishablyjurisdictionallyantistrophicallyspondylarthritiscommensurabilityotolaryngologisthypersexualitiesinexhaustibilitythermoplasticityunostentatiouslyhyperstimulating
...View all with 16 letters...
Phrases (308)
in a beastly mannerstrictly speakingcardiac glycosidechemical analysispodocarpus familyfamily locustidaecarya illinoensiscarya illinoinsissubfamily bovinaeofficial emissary
...View all with 16 letters...
Words (114)
straightforwardlyconstitutionalitymaterialisticallyneurophysiologistelectrostaticallyinconsequentiallysocioeconomicallypsycholinguisticsmultidisciplinaryprobabilisticallyinterdisciplinaryself-contradictoryisoelectronicallykaleidoscopicallyspondylolisthesisradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallyrationalisticallyhypnotizabilitiesmonosyllabicitiespaternalisticallypathophysiologiesunderstandabilitycryptocrystallineidiosyncraticallyencephalomyelitiscrystallographiesillusionisticallypostrevolutionaryuntranslatability
...View all with 17 letters...
Phrases (329)
salvia leucophyllabalaena mysticetuspearly everlastingfamily dasypodidaelycopus americanussubphylum craniatamalaysian languagetheological systemcylinder separatorcaesarian delivery
...View all with 17 letters...
Words (82)
characteristicallydisproportionatelyinconsequentialitypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalpolyesterificationspectroheliographynoncomprehensivelypathophysiologicalcylindrical-stemmedlaryngopharyngitislipopolysaccharidepostpsychoanalyticunconstitutionallylymphangiographiesstereospecificallytransformationallystoichiometricallyrecrystallizationsdiethylstilbestroldistinguishabilitymucopolysaccharidehypercholesteremiamagnetostrictivelysubmicroscopicallydehydrochlorinasesdehydrochlorinatesglycosaminoglycanstrichloroethylenesoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesis
...View all with 18 letters...
Phrases (307)
worldly possessionsbombycilla garrulusfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologynavigational systempodilymbus podicepscolumbia universityclass schizomycetes
...View all with 18 letters...
Words (49)
psychophysiologicalpolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilitycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallydiethylstilbesterolindividualisticallydiethylstilboestrolphenomenalisticallyphosphatidylcholinechromoblastomycosiscontradistinctivelythird-dimensionalityhysterosalpingogramcross-linguisticallythree-dimensionalityimpressionisticallymethylprednisoloneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshistopathologicallyhistoriographicallyhydrometeorologistspsychopharmacologicsymptomatologicallydiethylcarbamazinesdiethylstilbestrols
...View all with 19 letters...
Phrases (308)
building supply houseacetylsalicylic acidjohn millington syngefamily cynoglossidaegiles lytton stracheyfamily lepisosteidaefamily dasyproctidaecapital of kyrgyzstancalycanthus floridussalicylate poisoning
...View all with 19 letters...
Words (36)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyradioimmunoassayablelipochondrodystrophycrystallographicallyindistinguishabilitylymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesencephalomyocarditisphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercholesterolemichypercoagulabilitiesdimethylnitrosaminesplethysmographically
...View all with 20 letters...
Phrases (258)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesoryctolagus cuniculusbalance sheet analysisbyelorussian languagedianthus caryophyllus
...View all with 20 letters...
Words (14)
psychopharmacologicalotorhinolaryngologisthypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisacetylcholinesterasesotorhinolaryngologiesphotophosphorylationsintersubstitutabilityhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (196)
electrolytic condensernikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoidescynoglossum officinaleisle royal national park
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityotorhinolaryngologistselectrophysiologicallyencephalomyocarditisesPhrases (176)
lycopersicon esculentumhaliaeetus leucorhyphusaleksandr i. solzhenitsynloyalist volunteer forcesubfamily bassariscidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroidesmale reproductive system
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (131)
family threskiornithidaeposterior pituitary glandyellowstone national parkcalycanthus occidentalisthryothorus ludovicianuscanyonlands national parkbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillata
...View all with 23 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (85)
carnegie mellon universitylouis seymour bazett leakeymary wollstonecraft godwinzollinger-ellison syndromebrassica oleracea botrytisdistinguished flying crossalexandre emile jean yersinapocynum androsaemifoliumexistentialist philosophytechnology administration
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (69)
myroxylon balsamum pereiraefrancis scott key fitzgeraldsymphoricarpos orbiculatusedmund john millington syngepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonmichelson-morley experiment
...View all with 25 letters...
Phrases (49)
brassica oleracea gongylodessubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandbureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizans
...View all with 26 letters...
Phrases (44)
business environment analysisaleksandr sergeyevich pushkinaugustus welby northmore pugincommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (38)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Phrases (24)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testerfrancisco jose de goya y lucientes
...View all with 29 letters...
Phrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentscalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Phrases (11)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologyrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyermarine corps intelligence activityvladimir vladimirovich mayakovskihuygens' principle of superposition
...View all with 31 letters...
Phrases (16)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (11)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicessubacute inclusion body encephalitisunited states intelligence community
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicenational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
