Words Containing: I,G,Y
(In Any Order)
There are 6,344 words,
2,823 phrases and
0 abbr's with
I,G,Y in.
Best Scoring Words With: I,G,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
| zygotic | 7 | 22 | adjectiveadj | |||||
adjective • of or relating to a zygote | ||||||||
| cozying | 7 | 22 | verb, adjectivev, adj | |||||
noun • a padded cloth covering to keep a teapot warm adjective satellite • enjoying or affording comforting warmth and shelter especially in a small space • having or fostering a warm or friendly and informal atmosphere • suggesting connivance | ||||||||
| highway | 7 | 20 | nounn | |||||
noun • a major road for any form of motor transport | ||||||||
| zygosis | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| gauzily | 7 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| zygoid | 6 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| glazily | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| yakking | 7 | 19 | verb, adverbv, adv | |||||
noun • noisy talk • large long-haired wild ox of Tibet often domesticated verb • talk profusely | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (339)
playingstayingyellinghighwaydignitygravitybiologylightlydenyingtightlyburyinghygienegrizzlycopyingsyringerightlyyappingrelyingcyclingwyomingnightlyprodigyimageryyawningtidyingyelpingstylingundyingglorifyslayingangrilymagnifyvaryingtrilogyyakking
...View all with 7 letters...
Phrases (8)
fly highguy wiretying upkey ringwise guyglide bygym suitgive wayWords (540)
anythingstudyingcarryingmarryingslightlyannoyingworryingalmightydaylightegyptianpartyingapplyingbullyingideologyeyesightimplyingyearningregistrylovinglyhurryingbrightlysprayingstingrayskylighthygienicemptyingsyringesgiveawaylobbyingyodelingrallyingunifyingyieldingstrayinglynching
...View all with 8 letters...
Phrases (16)
by rightssign awayegg yielddrying upbig moneyditty baggive awayby designlaying ongregory i
...View all with 8 letters...
Words (841)
virginityimaginaryintegrityyggdrasilillegallyamazinglywillinglygenuinelyseeminglybiographyrecyclinganalyzingwhinnyingmagicallycopyrighthemingwaysmilinglylogicallysupplyingsociologygymnasiumpiggybackingenuityknowinglylongevitydaylightsplaythinganalysingambiguityvulgarityradiologypurifyingdigitallyverifyingshimmying
...View all with 9 letters...
Phrases (47)
high styleloya jirgaground ivygrey friarright awaygin rickeyegg layingivy leaguenot guiltyyoung bird
...View all with 9 letters...
Words (970)
everythingoriginallyterrifyinggenerositysatisfyinggymnasticstragicallyhorrifyingyugoslaviatestifyingunderlyingrightfullyphysiologymagnifyingvigorouslyobligatoryqualifyinggraciouslynegativitygratifyingnegativelysurgicallyplaywrighttoxicologydiligentlyshockinglyinsurgencyjustifyinglegitimacymisogynistneighborlyscathinglyportrayingsignifyingstunningly
...View all with 10 letters...
Phrases (81)
body weightenergy unitmaxim gorkydry wallinggrey willowwedding daytight moneygreek deityhanging flyivy leaguer
...View all with 10 letters...
Words (924)
geneticallyaccordinglyheavyweightbabysittingdaydreamingsovereigntyidentifyingcalligraphycontingencyexceedinglyunwittinglyunknowinglyoriginalityterminologysingularityreligiouslymultiplyingichthyologyfrightfullyiconographyunwillinglycriminologyeligibilityorganicallysymbolizinglingonberryscientologygullibilityinteragencyyugoslaviancopyrightedhypnotizingappallinglyplaywritingtypewriting
...View all with 11 letters...
Phrases (140)
genus myxinegrass familylaying claimhigh qualitylaying wastemighty mousebulb syringesingle entryplaying areadry cleaning
...View all with 11 letters...
Words (817)
psychologistincreasinglysurprisinglyaccompanyingstraightawaygynecologistaggressivelystorytellingmythologicalbiologicallyfigurativelytriglyceridedelightfullyconvincinglydisgustinglylegitimatelyelectrifyinghieroglyphicunsatisfyingmisogynisticrefreshinglytrigonometrybodybuildingunimaginablydisturbinglyegyptologistcongenialityecologicallyterrifyinglycompellinglybelligerencyphylogeneticungraciouslybegrudginglyforthrightly
...View all with 12 letters...
Phrases (182)
woody guthriestaying powerbody stockinggenus glycineshaking palsygenus syringadwight l. moodyinquiry agentstring theorybaby carriage
...View all with 12 letters...
Words (628)
psychologicalsignificantlyautobiographyinterestinglyprogressivelyhieroglyphicsphysiologicalgynaecologiststrategicallycategoricallyintelligentlyfrighteninglymagnificentlyastonishinglynitroglycerineverlastinglyideologicallypainstakinglyoveranalyzingbiotechnologygrammaticallyhypoglycaemicinfuriatinglydistressinglyenergeticallygynecologicalunflinchinglyunremittinglydisparaginglydeoxygenationsynchronisinghumiliatinglyhyperglycemicendocrinologyichthyologist
...View all with 13 letters...
Phrases (218)
harvey cushingvaginal arterygilbert murrayhigh-and-mightyproperty rightdwindling awaydizygotic twinpraying mantidradiant energygenus acinonyx
...View all with 13 letters...
Words (439)
cinematographyoverwhelminglygeographicallycytogeneticistpathologicallynitroglycerineexcruciatinglygynaecologicalembarrassinglylinguisticallysociologicallyunintelligiblyunconvincinglyentertaininglydemythologisedbiographicallydiagnosticallyastrologicallyunsuspectinglyanesthesiologysuggestibilityetymologicallydisapprovinglyhistoriographyunhesitatinglyethnologicallyoverpoweringlymagniloquentlyillegitimatelyimpregnabilitydemythologizeddisingenuouslythymectomizingdepolymerizingthyroglobulins
...View all with 14 letters...
Phrases (242)
pituitary glandhigh technologyveliky novgorodigor stravinskygenus gossypiumgenus syngoniumdrainage systemdizzy gillespieoyster dressingturkey stuffing
...View all with 14 letters...
Words (318)
psychologicallytechnologicallyanaesthesiologyphysiologicallychronologicallysynergisticallyoversimplifyingpsychobiologistcondescendinglydisappointinglyneurophysiologycytomegalovirusrecrystallizingdramaturgicallylogarithmicallytransmogrifyinggastronomicallyunquestioninglyseismologicallygynandromorphiccorrespondinglydemographicallyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitysidesplittinglyhyperimmunizingcommiseratinglyalgorithmicallyphysiographicalpsychoanalyzingmarriageabilityunintelligently
...View all with 15 letters...
Phrases (265)
syringa vulgarisbenefit of clergyasamiya languagemount nyiragongomail-order buyingsystem of weightsgenus sylvilagusgenus bombycillahyoscyamus nigerfamily triglidae
...View all with 15 letters...
Words (132)
hyperintelligentphylogeneticallyuncompromisinglypsychophysiologyunapologeticallypsychobiologicalphotographicallyparapsychologistinextinguishablyparadigmaticallypornographicallyparamagneticallyradiographicallytrinitroglycerinotolaryngologisthypersensitizingmicrogametophytehyperstimulatingparapsychologiesdimethylglyoximehyperventilatingphotolithographynonpsychologicalarchaeologicallypathophysiologichemoglobinopathycriminologicallycrossopterygiansorganizationallyichthyologicallyiconographicallycryptozoologistslyginopteridalesstenographicallyhypopigmentation
...View all with 16 letters...
Phrases (254)
italian greyhoundstrictly speakingchristian huygenscapital of hungarycardiac glycosidecygnus buccinatorcommercial agencyalan lloyd hodgkindwight lyman moodyautogenic therapy
...View all with 16 letters...
Words (87)
straightforwardlycounterinsurgencybacteriologicallyanthropologicallyneurophysiologistpsycholinguisticsradiobiologicallyunexchangeabilityparapsychologistsparasitologicallypathophysiologiesferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologylymphangiographiccytomegalovirusescytopathogenicityconfigurationallycytotechnologistspharmacologicallyimmunogeneticallyelectronegativitystrongyloidosisesoceanographicallybibliographicallyzoogeographicallysamoyedic-speakingphonocardiographyglycosaminoglycantrigonometricallyhyperintelligenceunintelligibilitychromolithography
...View all with 17 letters...
Phrases (233)
hypoglycemic agentinterstate highwaypearly everlastingmalaysian languagetheological systemantipsychotic drugcylindrical liningrepublic of hungarytypha angustifoliayeniseian language
...View all with 17 letters...
Words (49)
hypercoagulabilitypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalspectroheliographysphygmomanometrieshypophysectomizingpathophysiologicallaryngopharyngitislymphangiographiesautobiographicallydistinguishabilitymagnetostrictivelyphenomenologicallyophthalmologicallygeochronologicallyneuroendocrinologyglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesisneurophysiologistselectromyographiesultracentrifugallyneuropsychologistsmetallographicallydemythologizationselectrophysiologicpropagandisticallyrhinolaryngologistroentgenologicallyhistophysiologicalhydrometallurgical
...View all with 18 letters...
Phrases (253)
bombycilla garrulusrevolutionary groupfreudian psychologyafghan monetary unitnavigational systemfamily asparagaceaeantipsychotic agentfamily polygalaceaegenus chamaecytisusfulminating mercury
...View all with 18 letters...
Words (29)
psychophysiologicalcinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallycytopathogenicitiesmagnetohydrodynamicchromatographicallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectrophysiologieselectrophysiologistelectroretinographycharacterologicallyhistopathologicallyhistoriographicallyhydrometeorologicalhydrometeorologistspsychopharmacologicsymptomatologicallyphytogeographicallyphytohemagglutininssociolinguisticallypsychophysiologistspaleogeographicallyelectrocardiographyPhrases (191)
building supply housejohn millington syngefamily cynoglossidaealpine type of glaciergiles lytton stracheygenus symphoricarposbond-trading activitycapital of kyrgyzstanavogadro's hypothesissalicylate poisoning
...View all with 19 letters...
Words (17)
polyphiloprogenitivecrystallographicallyindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsroentgenographicallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (142)
oryctolagus cuniculusclyde william tombaughbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosfamily gasterosteidaeunabridged dictionarymilitary intelligenceglycerol tripalmitate
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychophysiologicallyclinicopathologicallyPhrases (119)
igor ivanovich sikorskybulgarian monetary unithungarian monetary unitextrauterine pregnancycynoglossum officinaleginglymostoma cirratumnorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaard
...View all with 21 letters...
Words (3)
otorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyPhrases (99)
high-density lipoproteinguatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitamygdalus communis amaraguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucas
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (61)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationfederal republic of germanyandrei andreyevich gromyko
...View all with 24 letters...
Phrases (29)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngereligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating system
...View all with 25 letters...
Phrases (31)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (29)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (18)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianussingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormone
...View all with 28 letters...
Phrases (13)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planninghuygens' principle of superposition
...View all with 31 letters...
Phrases (12)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusnonsteroidal anti-inflammatory drugprimary subtractive colour for lightlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
