Words Containing: H,R,T,Y
(In Any Order)
There are 3,518 words,
2,419 phrases and
0 abbr's with
H,R,T,Y in.
Best Scoring Words With: H,R,T,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| rhythms | 7 | 18 | nounn | |||||
noun • the basic rhythmic unit in a piece of music • recurring at regular intervals • an interval during which a recurring sequence of events occurs • the arrangement of spoken words alternating stressed and unstressed elements • natural family planning in which ovulation is assumed to occur 14 days before the onset of a period (the fertile period would be assumed to extend from day 10 through day 18 of her cycle) • (architecture) the repetitive use of a group of visual elements to establish a recognizable pattern | ||||||||
| rhythm | 6 | 17 | nounn | |||||
noun • the basic rhythmic unit in a piece of music • recurring at regular intervals • an interval during which a recurring sequence of events occurs • the arrangement of spoken words alternating stressed and unstressed elements • natural family planning in which ovulation is assumed to occur 14 days before the onset of a period (the fertile period would be assumed to extend from day 10 through day 18 of her cycle) • (architecture) the repetitive use of a group of visual elements to establish a recognizable pattern | ||||||||
| thrummy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| growthy | 7 | 17 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| thrifty | 7 | 16 | adjectiveadj | |||||
adjective • careful and diligent in the use of resources adjective satellite • mindful of the future in spending money | ||||||||
| swarthy | 7 | 16 | adjectiveadj | |||||
adjective satellite • naturally having skin of a dark color | ||||||||
| thruway | 7 | 16 | nounn | |||||
noun • a broad highway designed for high-speed traffic | ||||||||
| wreathy | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chytrid | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| therapy | 7 | 15 | nounn | |||||
noun • (medicine) the act of caring for someone (as by medication or remedial training etc.) | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (68)
historytherapythirstycharityshortlyashtrayearthlyrightlychristytherebyyoghurtthirdlyhartleyatrophyhydrantthyroidthriftyhydrateshysterthreadyswarthythruwaystarchybreathythroatylatherythyrsusyachterdrouthymotheryhelotrythymierchantryrhatanythyrses
...View all with 7 letters...
Phrases (3)
by heartheat rayarmy hutWords (132)
birthdaythursdaymccarthyunworthyhysteriabrightlyrhythmicstracheyheartilyfatherlymotherlyscratchyhystericthieverybutcheryheredityhydratedfeatherylethargydraughtystretchyhatcheryleatherybitcherythuggeryerythemachatterytriptychhilaritywitcheryfourthlysmotheryfortyishorthoepyhostelry
...View all with 8 letters...
Phrases (11)
by rightsr. h. tawneyin theoryholy writdry mouthhen partyderby hatthird eyeeye charthorsy set
...View all with 8 letters...
Words (218)
authoritychemistryhypocritehairstylecopyrightlabyrinthtreacherybrotherlyarchetypehystericsthrowawayunearthlyorthodoxyhydrationdystrophysprightlyweatherlysoutherlyseaworthydehydratesophistrythackeraycrotchetynortherlyforsythiahydratingtheocracydiathermyabernethythermallyairworthypyrethrumunthriftybrutishlyrhymester
...View all with 9 letters...
Phrases (20)
right awayhair stylebay wreathbody forthstay freshthrow awaytray clothmyrrh treeholy waterjohn tyler
...View all with 9 letters...
Words (410)
everythingthoroughlyhystericaltruthfullyhereditarydehydratedpsychiatryunbirthdayrightfullyinherentlyplaywrightupholsterypythagorasruthlesslystrychninearrhythmiatopographynewsworthyprehistorytypographyarchetypalsoothsayerpatriarchyapothecarytryptophantomographyhydrolyticstraightlythreepennynoteworthyarrhythmichypertenseflycatcherpennyworthrhythmical
...View all with 10 letters...
Phrases (65)
short storyhoney eateremery clothwheat berryterry clothbohr theorythird partyhouse partycherry treerock python
...View all with 10 letters...
Words (504)
photographypsychiatrictrustworthyhypothermiadehydrationhypermarketsynthesizerhyperactivefrightfullybathyspheretachycardiatracheotomycopyrightedsympathizerhypothermichairstylistpythagoreandehydratingtypographerthermopylaeornithologyrhinoplastyhypogastricnephrectomythrillinglyorthographytypographicfortnightlylithographysympathiserphysiatristrighteouslytechnocracymccarthyismheartlessly
...View all with 11 letters...
Phrases (90)
filthy lucrenodal rhythmheavy hittermathew bradycherry stonefanny wrightthomas hardynorth by westalpha rhythmcytochrome c
...View all with 11 letters...
Words (533)
psychiatristchristianitychemotherapyhypocriticalstraightawayhistoricallybloodthirstyanthropologyhystericallyhorizontallybiochemistryhypertensionhydrothermalrhythmicallyhysterectomyaromatherapyincoherentlytriumphantlyastrophysicshypochloritehypertensivephilanthropyotherworldlypyrotechnicsbreathlesslypsychotropicpraiseworthyhypnotherapybreathalyzerprophylacticcarbohydratehyperaciditythoracostomyforthrightlythunderously
...View all with 12 letters...
Phrases (110)
woody guthriemolly pitchermary mccarthyhorn of plentychristmas daynorthrop fryestring theorypoetic rhythmwatch crystaljockey shorts
...View all with 12 letters...
Words (443)
theoreticallyautobiographychrysanthemumpsychotherapyuntrustworthyphysiotherapyfrighteninglynorthwesterlyhyperactivitythyroidectomyhydroelectrichybridizationhallucinatorysynchronicitytheatricalityarchaeopteryxcryptographerthermodynamictreacherouslyanthropophagytypographicalpyrophosphatehydrogenationsoutheasterlyimmunotherapyhypertrophiedhypervelocitynightmarishlypolychromaticcatharticallysynchronisticpropheticallysouthwesterlynortheasterlyhypercritical
...View all with 13 letters...
Phrases (133)
bitter hickoryhydrated oxideby word of mouthcardiac rhythmorder of the dayproperty rightdoughnut fryerdata hierarchyshammy leatherheavy particle
...View all with 13 letters...
Words (370)
cinematographymetaphoricallywholeheartedlyhypersensitivecardiomyopathyastrophysicistthermodynamicselectrotherapyhyperventilatecharacterologypsychoneuroticnephrotoxicitynarcosynthesismicrochemistryphotogrammetryinheritabilityphosphorylatedhypothyroidismhydropneumaticpyelonephritisorthopedicallyplethysmographarchetypicallyneuropathologychromatographyhydrotherapisthydrocortisonehistoriographypraiseworthilycyproheptadinepachydermatousstretchabilityphosphorylatesheavyheartedlyhyperkeratotic
...View all with 14 letters...
Phrases (141)
thoracic cavityanthony burgessmyrrhis odoratachurch propertyx-ray photographpharaoh of egyptprimary featheroriental cherrychristopher fryright to liberty
...View all with 14 letters...
Words (321)
psychotherapistsynchronizationphysiotherapistheterosexualityparentheticallytherapeuticallysynchronisationstereochemistrylogarithmicallyauthoritativelycrystallographyarchitecturallyheartbreakinglyneuropsychiatrypsychiatricallyultrasonographyimperishabilitythyrocalcitoninapproachabilityhypersensitizedchemoautotrophyheterogeneouslythyroidectomiesalgorithmicallytenderheartedlymerchantabilityastrophysicistspsychohistoriandishearteninglyhypersalivationpsychometricianradioautographycyproheptadinesautotrophicallyhyperstimulated
...View all with 15 letters...
Phrases (154)
charlotte cordayx-ray photographyrhythmic patterncantering rhythmhoneymoon resortshorthand typistmythical monsterfour-part harmonydehydrated foodsthree-day measles
...View all with 15 letters...
Words (174)
pheochromocytomahemorrhoidectomycatastrophicallytriphenylmethanehyperintelligenthyperventilationelectromyographypharmaceuticallysphygmomanometererythroblastosisthermostaticallythrombocytopeniaelectrochemistryhypersensitivityphotographicallyparapsychologistneuropsychiatrichypersalivationsheterokontophytathermometricallyantistrophicallyspondylarthritishypersensitizingmicrogametophytehypersexualitiespolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationthermoregulatoryhypersusceptibleparasympatheticshyperthyroidismshyperventilating
...View all with 16 letters...
Phrases (195)
italian greyhoundchristian huygenscapital of hungarygenus crotaphytusacross the countrynevil shute norwayautogenic therapythai monetary unityeoman of the guardschool dictionary
...View all with 16 letters...
Words (108)
straightforwardlyanthropologicallyparathyroidectomyperchloroethyleneneurophysiologistthermodynamicallyphilanthropicallypsychotherapeutichyperreactivitiesphysiotherapeuticthermoperiodicityhyperstimulationsparapsychologistsspectrophotometryhyperventilationsmonochromaticallysphygmomanometersthrombocytopeniaschlortetracyclinemammothermographyarchitectonicallymorphogeneticallycrystallographerscrystallographieshyperalimentationlymphogranulomataprotoanthropologytrichloroethylenebathythermographsstereophotographypheochromocytomastransthoracicallynephelometricallyelectrochemicallydehydrochlorinate
...View all with 17 letters...
Phrases (200)
division bryophytaczech monetary unitmary mcleod bethuneinterstate highwaysubphylum craniataotto fritz meyerhofantipsychotic drugfamily trochilidaepetasites hybridushereditary pattern
...View all with 17 letters...
Words (72)
characteristicallyhypercoagulabilityhyperaldosteronisminterchangeabilityhypersensitivenessmethyltestosteronehypersensitivitieshypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismanthropocentricitylaryngopharyngitisperchloroethylenestriphosphopyridinestoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadiethylstilbestrolhypercholesteremiasaccharomycetaceaehydroflumethiazidepheochromocytomatadehydrochlorinateddehydrochlorinatestrichloroethylenesorthopsychiatristsspectrographicallyaerothermodynamicsneurophysiologistsneuropsychiatristselectromyographiesneuropsychologists
...View all with 18 letters...
Phrases (216)
family physeteridaedame sybil thorndikelachrymal secretionafghan monetary unitjohn orley allen tatefamily trichechidaeshort-term liabilityfamily loranthaceaehypostasis of christarchitectural style
...View all with 18 letters...
Words (58)
hyperparathyroidismhydrochlorothiazidecinematographicallyhypersensitizationsotorhinolaryngologyhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsimmunocytochemistrydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllmagnetohydrodynamicphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphoenolpyruvatechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylcholanthrenesmethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibilitycharacterologically
...View all with 19 letters...
Phrases (196)
hydrastis canadensisgiles lytton stracheyphytolacca americanagenus cryptobranchusavogadro's hypothesiscalycanthus floridusathyrium filix-feminaathyrium pycnocarponchinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (40)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveparathyroidectomizedlipochondrodystrophycrystallographicallyhyperadrenocorticismlymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphoenolpyruvatesneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpseudoparenchymatoushydrochlorothiazidesmicrophotometricallypsychopharmacologisthypercholesterolemichypercoagulabilities
...View all with 20 letters...
Phrases (182)
honduran monetary unityellow-shafted flickerbalaenoptera physalusfamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthdianthus caryophyllusbenjamin henry latrobemilton snavely hershey
...View all with 20 letters...
Words (12)
otorhinolaryngologisthypersusceptibilitiesimmunocytochemistriesacetylcholinesterasesotorhinolaryngologieselectromyographicallyphotolithographicallyphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (150)
aleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiagricultural chemistryhans holbein the younger
...View all with 21 letters...
Words (11)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesmicrospectrophotometryPhrases (123)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factmultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinrhythm and blues musician
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (93)
family threskiornithidaekazakhstani monetary unitthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorgroup pteridospermaphytasearch and destroy missionornithorhynchus anatinus
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (69)
division heterokontophytasubphylum cephalochordataprivately held corporationprimary sex characteristicdistinguished flying crossantiarrhythmic medicationfluoxetine hydrocholoridetechnology administrationhypersensitivity reactionmohorovicic discontinuity
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyuvulopalatopharyngoplastyPhrases (64)
igor fyodorovich stravinskymary wollstonecraft shelleysymphoricarpos orbiculatusmodest petrovich mussorgskypolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddington
...View all with 25 letters...
Phrases (47)
hunting and gathering societydorothy mary crowfoot hodgkinemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (32)
nikita sergeyevich khrushchevaugustus welby northmore puginpull the wool over someone's eyesthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulusatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (26)
triphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulosesingle nucleotide polymorphism
...View all with 28 letters...
Phrases (13)
disorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicbreach of the covenant of warrantyfeodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornmucocutaneous lymph node syndromehenri rene albert guy de maupassantdryopteris thelypteris pubescens
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
primary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreashuygens' principle of superpositionnorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (15)
hierarchical classification systemsergei aleksandrovich koussevitzkycercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (9)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scanneridiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn
