Words Containing: H,I,T,Y
(In Any Order)
There are 4,146 words,
2,316 phrases and
0 abbr's with
H,I,T,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
chintzy | 7 | 24 | adjectiveadj | |||||
adjective satellite • of very poor quality; flimsy • embarrassingly stingy | ||||||||
sixthly | 7 | 20 | adverbadv | |||||
adverb • in the sixth place | ||||||||
thickly | 7 | 19 | adverbadv | |||||
adverb • spoken with poor articulation as if with a thick tongue • in a concentrated manner • with a thick consistency • with thickness; in a thick manner • in quick succession | ||||||||
kitschy | 7 | 19 | adjectiveadj | |||||
adjective satellite • effusively or insincerely emotional | ||||||||
fifthly | 7 | 19 | ||||||
adverb • in the fifth place | ||||||||
shticky | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
diptych | 7 | 18 | nounn | |||||
noun • a painting or carving (especially an altarpiece) on two panels (usually hinged like a book) | ||||||||
twitchy | 7 | 18 | adjectiveadj | |||||
adjective • Susceptible to twitching a lot. • Irritable, cranky | ||||||||
kything | 7 | 18 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
flighty | 7 | 17 | adjectiveadj | |||||
adjective satellite • guided by whim and fancy • unpredictably excitable (especially of horses) | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (92)
historythirstycharitylightlytimothytightlycynthiastylishwhitneyrightlychristynightlythirdlytyphoidhastilythyroidthriftyflightyweightythicklyblightykitschypythiaswhitelychintzyscythiathionylsnitchydiptychhypatiathyminesightlypithilylithelytwitchy
...View all with 7 letters...
Phrases (2)
the citytoy withWords (158)
anythingbirthdayhumanityslightlyalmightydaylighteyesighthumilityhysteriahumiditybrightlychastitymythicalhypnoticrhythmicskylightheartilyhystericdimethylthieveryheredityhyacinthmightilyblithelybitcheryyachtingscythianhobbyisttriptychknightlyhilaritywitcherynihilityfortyishepiphyte
...View all with 8 letters...
Phrases (14)
by rightsin the wayin theoryholy writally withthird eyei timothyshift keynaha citywhite yam
...View all with 8 letters...
Words (298)
authoritychemistrypsychotichypocritesynthetichairstylephysicisthostilitycopyrightlabyrinthhypnotizedaylightsplaythinghypnotisthystericssynthesisethicallyunsightlyethnicityhypnotismchantillyhygienistdichotomyhealthilyhydrationsprightlylymphatichypnotiseantipathystylishlysophistryhaltinglyhesitancywealthilybimonthly
...View all with 9 letters...
Phrases (16)
high styleitchy feetii timothyright awayhair stylewild thymewhite lilyparty whiphairy roothairy tare
...View all with 9 letters...
Words (441)
everythinghystericalhypothesishypnotizedhereditarysympathizepsychiatryfaithfullyunbirthdayrightfullyinherentlystealthilyplaywrightdishonestystrychninearrhythmiascathinglysympathiseprehistoryinhumanityhabituallypatriarchysynthesizehypnotisedhydrolyticasphyxiatestraightlyethnicallysyphiliticarrhythmicsociopathyhauntinglysynthesisetouchinglyrhythmical
...View all with 10 letters...
Phrases (40)
hindu deityby the piecebody weighttight moneythird partyray of lightbasil thymepotty chairpernyi mothholy spirit
...View all with 10 letters...
Words (561)
technicallypsychiatrichospitalitysympatheticheavyweighthypothermiadehydrationtchaikovskysynthesizerhyperactiveichthyologyfrightfullypolytechnicmetaphysicssynesthesiatachycardiasynthesizedcopyrightedasphyxiatedsympathizerhypnotizinghypothermichairstylistphysicalitydehydratingornithologyrhinoplastydishonestlyhypogastricsycophantichypoplasticpennyweightxylophonistthrillinglymethylamine
...View all with 11 letters...
Phrases (72)
high qualitymighty mousefilthy lucrebilly the kidheavy hittertightly knitpoint the wayfanny wrightcity of lightwhiskey neat
...View all with 11 letters...
Words (637)
psychiatristpsychologistchristianityhypocriticalstraightawayhypotheticalhistoricallyauthenticitybloodthirstymetaphysicalmythologicalpsychopathichystericallyhorizontallyasphyxiationbiochemistrytechnicalitybiosynthesisdelightfullypatheticallyhypertensionanaphylacticrhythmicallyposthypnoticincoherentlytriumphantlytheophyllineastrophysicshypochloriteemphaticallyhypertensivephilanthropypyrotechnicsmethodicallypsychotropic
...View all with 12 letters...
Phrases (94)
woody guthriemolly pitchermount whitneyathletic typechinese deityphantasy lifechristmas daydwight l. moodystring theorypoetic rhythm
...View all with 12 letters...
Words (526)
theoreticallyhomosexualityautobiographypsychosomaticphysiotherapyfrighteninglyastonishinglybiotechnologyhyperactivityunsympatheticaestheticallycholecystitisthyroidectomyhydroelectrichybridizationhallucinatorysynchronicityantipsychotictheatricalityhumiliatinglystaphylococciichthyologistthermodynamicsyntheticallytypographicalacetylcholinephysostigminehypothesisingtheologicallysyphilizationlymphoblastichydrogenationuninhibitedlyendolymphaticimmunotherapy
...View all with 13 letters...
Phrases (105)
bitter hickoryhydrated oxidecardiac rhythmhigh-and-mightyproperty rightbilly mitchelldata hierarchyheavy particlephrygian deitysphyrna tiburo
...View all with 13 letters...
Words (474)
hypotheticallycinematographymetaphoricallymathematicallyhypersensitivealphabeticallycardiomyopathyphotosynthesisastrophysicistpathologicallythermodynamicshyperventilatepsychoanalyticchemosynthesispsychoneuroticmetaphysicallymetempsychosistelepathicallynephrotoxicityscholasticallynarcosynthesismicrochemistryinheritabilityhypothyroidismhydropneumaticpyelonephritisorthopedicallyarchetypicallyunthinkabilitydemythologisedphotosynthetichydrotherapisttelephonicallychemosynthetichydrocortisone
...View all with 14 letters...
Phrases (132)
thoracic cavitydimethyl ketonemyrrhis odoratahigh technologyprimary feathertypha latifoliaoriental cherrychristopher fryfamily bothidaeright to liberty
...View all with 14 letters...
Words (376)
psychotherapisttechnologicallysynchronizationanaesthesiologyphysiotherapistheterosexualitysympathomimeticparentheticallypsychobiologisttherapeuticallysynchronisationmethylphenidatestereochemistryphotosynthesizelogarithmicallyauthoritativelysympatheticallyarchitecturallyheartbreakinglyeuphemisticallyneuropsychiatrypsychiatricallyimperishabilitykinestheticallythyrocalcitoninapproachabilityunchangeabilityhypersensitizedpsychophysicistthyroidectomiesalgorithmicallymerchantabilitymethylxanthinesastrophysicistsdisenchantingly
...View all with 15 letters...
Phrases (159)
system of weightspsychotic beliefnational holidayrhythmic patterncantering rhythmshorthand typistmythical monsterlymphatic vesselbuckthorn familybathyal district
...View all with 15 letters...
Words (192)
enthusiasticallyhemorrhoidectomycatastrophicallytriphenylmethanehyperintelligenthyperventilationpsychoanalyticalphylogeneticallypharmaceuticallyerythroblastosisthermostaticallythrombocytopeniaelectrochemistryhypersensitivityphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablythermometricallyantistrophicallyspondylarthritishypersensitizingmicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationhypersusceptibleparasympatheticshyperthyroidisms
...View all with 16 letters...
Phrases (173)
italian greyhoundchristian huygenscapital of hungarydwight lyman moodynevil shute norwayautogenic therapythai monetary unitmechanical systemschool dictionarymythical creature
...View all with 16 letters...
Words (124)
straightforwardlyanthropologicallyparathyroidectomyneurophysiologistthermodynamicallyphilanthropicallypsycholinguisticspsychotherapeutichyperreactivitiesphysiotherapeuticunexchangeabilitythermoperiodicityspondylolisthesishyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitiesthrombocytopeniaschlortetracyclinehypophysectomizespathophysiologieshyposensitizationhypophysectomisedarchitectonicallymorphogeneticallyhypophysectomizedencephalomyelitiscrystallographieslymphadenopathieshyperalimentationcytopathogenicitytrichloroethylenecytotechnologiststhiodiphenylamine
...View all with 17 letters...
Phrases (196)
division bryophytaczech monetary unithypoglycemic agentinterstate highwaysubphylum craniatatheological systemotto fritz meyerhofantipsychotic drugfamily trochilidaecalycanthus family
...View all with 17 letters...
Words (81)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilityhypersensitivenesshypersensitivitieshypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismhypophysectomizingpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitispostpsychoanalytictriphosphopyridineimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadiethylstilbestroldistinguishabilityhypercholesteremiahydroflumethiazideophthalmologicallydehydrochlorinateddehydrochlorinatestrichloroethylenesorthopsychiatristsspectrographicallyaerothermodynamics
...View all with 18 letters...
Phrases (195)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionafghan monetary unitclass schizomycetesfamily trichechidaeantipsychotic agentgenus chamaecytisusshort-term liability
...View all with 18 letters...
Words (63)
hyperparathyroidismhydrochlorothiazidecinematographicallyhypersensitizationsotorhinolaryngologyhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibility
...View all with 19 letters...
Phrases (215)
john millington syngehydrastis canadensisgiles lytton stracheyphytolacca americanadivision schizophytaavogadro's hypothesiscalycanthus floridusathyrium filix-feminaathyrium pycnocarponchinese monetary unit
...View all with 19 letters...
Words (41)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveparathyroidectomizedlipochondrodystrophycrystallographicallyhyperadrenocorticismindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalelectrophysiologistsimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazidespsychopathologicallymicrophotometricallypsychopharmacologist
...View all with 20 letters...
Phrases (190)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysisclyde william tombaugh
...View all with 20 letters...
Words (13)
otorhinolaryngologisthypersusceptibilitiesimmunocytochemistriesacetylcholinesterasesotorhinolaryngologieselectromyographicallyphotolithographicallyphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (150)
aleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphusagricultural chemistry
...View all with 21 letters...
Words (8)
spectrophotometricallyintercomprehensibilityotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesmicrospectrophotometryPhrases (131)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (87)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorgroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (70)
division heterokontophytaprivately held corporationprimary sex characteristicdistinguished flying crossantiarrhythmic medicationfluoxetine hydrocholorideexistentialist philosophytechnology administrationhypersensitivity reactionmohorovicic discontinuity
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (64)
igor fyodorovich stravinskysymphoricarpos orbiculatusmodest petrovich mussorgskyedmund john millington syngepolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experiment
...View all with 25 letters...
Phrases (47)
hunting and gathering societydorothy mary crowfoot hodgkinemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (34)
nikita sergeyevich khrushchevaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulus
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (28)
triphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (13)
disorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicfeodor mikhailovich dostoyevskyfibrocystic disease of the breast
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornhenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trends
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (10)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planninghuygens' principle of superpositionnorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (14)
hierarchical classification systemsergei aleksandrovich koussevitzkycercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn