Words Containing: G,R,E,Y
(In Any Order)
There are 2,726 words,
2,469 phrases and
0 abbr's with
G,R,E,Y in.
Best Scoring Words With: G,R,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jaggery | 7 | 19 | nounn | |||||
noun • unrefined brown sugar made from palm sap | ||||||||
kerygma | 7 | 17 | nounn | |||||
noun • preaching the gospel of Christ in the manner of the early church | ||||||||
waggery | 7 | 15 | nounn | |||||
noun • waggish behavior • a quaint and amusing jest | ||||||||
gyppers | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
yerking | 7 | 15 | verbv | |||||
verb • To stab. • To throw or thrust with a sudden, smart movement; to kick or strike suddenly; to jerk. • To strike or lash with a whip or stick. • To rouse or excite. • To bind or tie with a jerk. | ||||||||
wiggery | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
forgery | 7 | 14 | nounn | |||||
noun • a copy that is represented as the original • criminal falsification by making or altering an instrument with intent to defraud | ||||||||
voyager | 7 | 14 | verb, nounv, n | |||||
noun • a traveler to a distant land (especially one who travels by sea) | ||||||||
gravely | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in a grave and sober manner • to a severe or serious degree | ||||||||
synergy | 7 | 14 | nounn | |||||
noun • the working together of two things (muscles or drugs for example) to produce an effect greater than the sum of their individual effects | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (114)
youngergermanysurgerytragedygallerygrocerygreatlygregorysyringeallergylargelyurgencyrelyingforgeryeagerlyimageryvoyagerraggedygravelyjaggeryprogenysynergyregencygunnerygretzkygreeleygruyerecryogenorangeypiggerybeggaryretyingyardagegreyishroguery
...View all with 7 letters...
Phrases (7)
guy wiregrey foxgrey hengrey jaykey ringgray henguy ropeWords (191)
strategyurgentlycategoryhydrogenyearningregistrygeometrysyringesgreeneryallegorygargoylegreenwaysavageryrelayinglethargydrudgerygoodyearreadyinggingerlyglycerinnegatorygreedilyguernseylayeringglitteryridgewaythuggeryvinegaryferryinggentrifygravellyglycerolruggedlybeggarlygrayness
...View all with 8 letters...
Phrases (20)
zane greysentry gogray areaglory peagregory iroger frygrey areagrey bodygrey sagegrey sole
...View all with 8 letters...
Words (264)
emergencygenerallypregnancylegendaryintegrityregularlystrangelygraveyardgeographyrecyclingyoungsterclergymangreyhoundverifyingneurologycryogenicsurveyingglycerineprettyingpageantrygyroscopehydrangeabudgetaryparleyingreburyingaveragelylaryngealpanegyricgreystonepetrologyremedyingforeignlypyrogenicmuybridgelegionary
...View all with 9 letters...
Phrases (37)
prayer ruggrey friarbog myrtlegin rickeyturkey legcrazy gluegerm layerany longerglory fernglory hole
...View all with 9 letters...
Words (363)
everythingterrifyinggenerositymontgomeryunderlyinggracefullygenerouslyarcheologyyoungberryregulatorygettysburginsurgencygooseberryneighborlyphrenologygrievouslygratefullynumerologyderogatoryregularitynephrologymetallurgyoverpayingcertifyinghieroglyphjourneyingremarryingstringencypharyngealrectifyingoverlayingcryogenicsdegeneracyreapplyingladyfinger
...View all with 10 letters...
Phrases (69)
energy unitgolf playergrey mattergrey willowgreek deityivy leaguergray marketgray mattergrace kellygrape jelly
...View all with 10 letters...
Words (400)
daydreamingsovereigntydangerouslyarchaeologyregrettablyterminologyreligiouslyregretfullymeteorologygastrectomylingonberryskulduggeryinteragencycopyrightedtypewritinggrotesquelypythagoreandehydratingphraseologytypographercarriagewaylingeringlydeservinglydemagogueryneighbourlytroglodytesirregularlyfragmentaryegregiouslyrighteouslysynergisticmerrymakingreflexologystringentlyroleplaying
...View all with 11 letters...
Phrases (107)
genus styraxbulb syringeenergy levelroentgen rayhoney badgersingle entryplaying areaoryx gazelladry cleaningturdus greyi
...View all with 11 letters...
Words (403)
increasinglychoreographyaggressivelystorytellingfigurativelytriglyceridecourageouslyneurosurgeryelectrifyinghieroglyphicrefreshinglyskullduggerytrigonometryoutrageouslyoceanographyterrifyinglybelligerencybegrudginglystaggeringlyirregularitystereotypinghydrogenatedsuperhighwaydepressinglydespairinglyresoundinglygroundlesslydiversifyinglaryngoscopeembryologistunwaveringlycardiomegalyrheumatologyneurobiologyreassuringly
...View all with 12 letters...
Phrases (154)
woody guthriemary magdalenstaying powergenus syringainquiry agentstring theorybaby carriagegenus apteryxgenus cyperusacid hydrogen
...View all with 12 letters...
Words (324)
interestinglyprogressivelyhieroglyphicsstrategicallycategoricallyfrighteninglynitroglycerineverlastinglypsychosurgeryoveranalyzingdehydrogenasedistressinglyenergeticallyextravagantlyunremittinglycryptographerhyperglycemicendocrinologyunrelentinglydisgracefullygeometricallymagisteriallyroentgenologyhydrogenationunforgettablyoverbearinglygeostationarydaguerreotypeinterrogatoryproselytizingthreateninglybelligerentlyintermarryingpenetratinglyunderstudying
...View all with 13 letters...
Phrases (188)
harvey cushingvaginal arterygilbert murraywaste of energyproperty rightgenus bradypuscedar mahoganydoughnut fryerradiant energyheavy hydrogen
...View all with 13 letters...
Words (242)
cinematographyoverwhelminglygeographicallynitroglycerineexcruciatinglycharacterologyembarrassinglygeosynchronousphotogrammetrygovernmentallyelectromyogramentertaininglyplethysmographneuropathologyoverpoweringlyimpregnabilitydepolymerizinggenerationallylightheartedlygeohydrologistheterozygosityosmoregulatorydehydrogenasesgreatheartedlyhypoallergenicupgradeabilitymyrmecologistsegocentricallyhyperpigmentedacceleratinglyantiregulatoryelectrosurgerysacrilegiouslyovergenerouslyexasperatingly
...View all with 14 letters...
Phrases (208)
anthony burgesstubal pregnancyveliky novgorodemergency brakepharaoh of egyptdrainage systemoyster dressingturkey stuffingtattletale greyoyster stuffing
...View all with 14 letters...
Words (174)
synergisticallyoversimplifyingneurophysiologycytomegalovirusrecrystallizingencephalographycorrespondinglydemographicallyheartbreakinglyinterrogativelyhyperimmunizingheterogeneouslycommiseratinglymarriageabilityretrogressivelynonbelligerencydishearteninglyhyperaggressivedaguerreotypistuncopyrightablehypercoagulableoverclassifyingnitroglycerineshypervigilancesgravimetricallyresystematizingelectromyogramstelegraphicallydisconcertinglylepidopterologyroentgenographyagranulocytosesstereologicallymetallurgicallyunderstandingly
...View all with 15 letters...
Phrases (238)
benefit of clergymail-order buyinghyoscyamus nigerfamily triglidaeleveraged buyoutgempylus serpensarachis hypogaeacantering rhythmstrategic buyoutmask of pregnancy
...View all with 15 letters...
Words (73)
hyperintelligentelectromyographysphygmomanometerdendrochronologyparamagneticallytrinitroglycerinhypersensitizingmicrogametophytehyperstimulatingparapsychologiesthermoregulatoryhyperventilatingsphygmomanometryglossopharyngealarchaeologicallycrossopterygianslyginopteridalesrechromatographystenographicallyflabbergastinglyflexographicallyflibbertigibbetygastroenterologystereoregularityforethoughtfullyprotoarchaeologydaguerreotypistsstrongyloidiasespetrographicallyoligodendrocytesbathythermographgeneralizabilitybiodegradabilityechocardiographyimmunoregulatory
...View all with 16 letters...
Phrases (230)
italian greyhoundstrictly speakingchristian huygenscardiac glycosidegenus crotaphytusbluegrass countrycommercial agencyautogenic therapyexemplary damagesyeoman of the guard
...View all with 16 letters...
Words (48)
counterinsurgencybacteriologicallyneurophysiologistsphygmomanometersmammothermographyferrimagneticallymorphogeneticallylexicographicallylaryngopharyngealcrystallographerscrystallographiesmicropaleontologygastroenterostomycytomegaloviruseselectronegativitystrongyloidosisesoceanographicallybathythermographsstereophotographyzoogeographicallyglossopharyngealstrigonometricallyhyperintelligenceneuropharmacologyneurophysiologiesphosphoglycerateselectrometallurgyelectromyographicneuropsychologiesneuropsychologistsuperheavyweightselectrophysiologyhyperpigmentationdephosphorylatingpalaeoethnography
...View all with 17 letters...
Phrases (232)
dame margot fonteyngopherus polypemusinterstate highwaypearly everlastingcoccygeal vertebrarepublic of hungarygettysburg addressgreater yellowlegscrataegus monogynafamily engraulidae
...View all with 17 letters...
Words (30)
hypercoagulabilityinterchangeabilityneuropsychologicalspectroheliographysphygmomanometrieslymphangiographiesmagnetostrictivelygeochronologicallyneuroendocrinologygranulocytopoiesesspectrographicallygranulocytopoiesisneurophysiologistselectromyographiesultracentrifugallyneuropsychologistsmetallographicallyelectrooculographyelectrophotographyelectrophysiologicpalaeoanthropologyroentgenologicallycryptogrammataceaehydrometallurgicalhydrometallurgistshydrometeorologieshydrometeorologistdihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (212)
revolutionary groupfreudian psychologygenus styracosaurusafghan monetary unitfamily asparagaceaemegacycle per secondfulminating mercurygene delivery vectorcrataegus oxycanthaarthur garfield hays
...View all with 18 letters...
Words (18)
cinematographicallyextralinguisticallyparthenogeneticallymagnetohydrodynamicechoencephalographydehydrochlorinatingelectromagneticallyhysterosalpingogramelectrophysiologieselectrophysiologistelectroretinographycharacterologicallyhydrometeorologicalhydrometeorologistsphytogeographicallypaleogeographicallymedroxyprogesteroneelectrocardiographyPhrases (154)
alpine type of glaciergiles lytton stracheygenus cryptobranchusgenus symphoricarposavogadro's hypothesishydrobates pelagicusuniversity of chicagocrataegus oxyacanthaunix operating systemghanian monetary unit
...View all with 19 letters...
Words (12)
polyphiloprogenitivelymphogranulomatosesoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsroentgenographicallypsychopharmacologiessyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (120)
byelorussian languagemagnetic bubble memoryluscinia megarhynchosfamily gasterosteidaeunabridged dictionarymilitary intelligencelaw enforcement agencyglycerol tripalmitateegyptian monetary unitaustralian bonytongue
...View all with 20 letters...
Words (5)
phosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallyantiferromagneticallyPhrases (98)
bulgarian monetary unithungarian monetary unitextrauterine pregnancynorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaardsamuel taylor coleridgeagricultural chemistryfamily myrmecophagidae
...View all with 21 letters...
Words (3)
electroencephalographyphosphoglyceraldehydeselectrophysiologicallyPhrases (88)
high-density lipoproteinguatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleytroglodytes troglodytesdoctor of sacred theologynotemigonus crysoleucas
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (54)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationfederal republic of germanyhenry wadsworth longfellowandrei andreyevich gromyko
...View all with 24 letters...
Phrases (26)
diamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyreligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska river
...View all with 25 letters...
Phrases (28)
brassica oleracea gongylodeshunting and gathering societyevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndrome
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (28)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (9)
disorganized type schizophreniaautomatic data processing systemscrutin uninominal voting systemedward george earle bulwer-lyttonhydrangea macrophylla hortensisfrancisco jose de goya y lucientespressure-feed lubricating systemenvironmental protection agencyimaginary part of a complex numberPhrases (12)
great smoky mountains national parkdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityhuygens' principle of superpositionnorth atlantic treaty organization
...View all with 31 letters...
Phrases (14)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusnonsteroidal anti-inflammatory drugprimary subtractive colour for lightoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay