Words Containing: G,I,R,Y
(In Any Order)
There are 3,028 words,
2,003 phrases and
0 abbr's with
G,I,R,Y in.
Best Scoring Words With: G,I,R,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
| jurying | 7 | 18 | verb, nounv, n | |||||
verb • To judge by means of a jury. | ||||||||
| rhyming | 7 | 16 | noun, adjectiven, adj | |||||
adjective • having corresponding sounds especially terminal sounds | ||||||||
| wriggly | 7 | 15 | adjectiveadj | |||||
adjective satellite • moving in a twisting or snake-like or wormlike fashion | ||||||||
| yerking | 7 | 15 | verbv | |||||
verb • To stab. • To throw or thrust with a sudden, smart movement; to kick or strike suddenly; to jerk. • To strike or lash with a whip or stick. • To rouse or excite. • To bind or tie with a jerk. | ||||||||
| wiggery | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| gravity | 7 | 14 | nounn | |||||
noun • (physics) the force of attraction between all masses in the universe; especially the attraction of the earth's mass for bodies near its surface • a manner that is serious and solemn • a solemn and dignified feeling | ||||||||
| rightly | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • with honesty | ||||||||
| prodigy | 7 | 14 | nounn | |||||
noun • an unusually gifted or intelligent (young) person; someone whose talents excite wonder and admiration • a sign of something about to happen • an impressive or wonderful example of a particular quality | ||||||||
| glorify | 7 | 14 | verbv | |||||
verb • praise, glorify, or honor • bestow glory upon • elevate or idealize, in allusion to Christ's transfiguration • cause to seem more splendid | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
gyriWords (95)
gravityburyinggrizzlysyringerightlyrelyingprodigyimageryglorifyangrilyvaryingtrilogybigotryrhymingstringyspringyliturgyrigidlygrayishphrygiagristlygratifypiggeryretyinggreyishwrigglysyringagrayinggreyingyirringscryingpreyingprayingdrayingjurying
...View all with 7 letters...
Phrases (2)
guy wirekey ringWords (193)
carryingmarryingworryingpartyingyearningregistryhurryingbrightlysprayingstingraysyringesrallyingstrayinggratuityrigidityplaygirlrelayingdirtyingtarryingcurryingreadyinggingerlyglyceringreedilygraylinglayeringglitteryridgewayhungrilyboringlyvinegaryferryinggentrifyphrygiangarlicky
...View all with 8 letters...
Phrases (7)
by rightsdrying upgregory igin rummydirty dogrusty rigtrying onWords (328)
virginityimaginaryintegrityyggdrasilbiographyrecyclingcopyrightvulgarityradiologypurifyingverifyingmigratorycryogenicsurveyingoligarchyfragilityscurryingdignitaryglycerinevaryinglyglaringlyprettyingsprightlysparinglyfrigidityquarryingparleyingroaringlyreburyingfrugalityhydratingsignatorypanegyricvaingloryratifying
...View all with 9 letters...
Phrases (27)
loya jirgaground ivygrey friarright awaygin rickeyyoung birdyoung girlholy grailglory lilygrey birch
...View all with 9 letters...
Words (432)
everythingoriginallyterrifyinggenerositytragicallyhorrifyingunderlyingrightfullyvigorouslyobligatorygraciouslygratifyingsurgicallyplaywrightinsurgencyneighborlyportrayinggrievouslygloriouslycharminglyrigorouslyregularitycardiologyclarifyingsingularlyoverpayingstrikinglylaryngitisalarminglycertifyingprofligacystraightlyparalysinghieroglyphmortifying
...View all with 10 letters...
Phrases (44)
energy unitmaxim gorkydry wallinggrey willowgreek deityivy leaguerbing crosbyglyptic artray of lightworking day
...View all with 10 letters...
Words (463)
accordinglydaydreamingsovereigntycalligraphyoriginalityterminologysingularityreligiouslyfrightfullyiconographycriminologyorganicallylingonberryinteragencycopyrightedplaywritingtypewritingcryobiologydehydratingantigravitycarriagewayornithologygraphicallyhypogastriclingeringlythrillinglydeservinglyneighbourlyirregularlytypographicegregiouslygrandiosityfortnightlylithographyrighteously
...View all with 11 letters...
Phrases (76)
grass familybulb syringesingle entryplaying areadry cleaningturdus greyirunning playbilly grahamafrican greymemory image
...View all with 11 letters...
Words (445)
increasinglysurprisinglystraightawayaggressivelystorytellingfigurativelytriglycerideelectrifyinghieroglyphicrefreshinglytrigonometrydisturbinglyterrifyinglybelligerencyungraciouslybegrudginglyforthrightlymicrobiologystaggeringlyirregularitystereotypingbibliographyincorrigiblysuperhighwaydepressinglydespairinglyresoundinglydiversifyinghydrographicprodigiouslyembryologiststylographicunwaveringlygratifyinglygratuitously
...View all with 12 letters...
Phrases (109)
woody guthriestaying powergenus syringainquiry agentstring theorybaby carriagesign industryacid hydrogenfrighten awayfruiting body
...View all with 12 letters...
Words (347)
autobiographyinterestinglyprogressivelyhieroglyphicsstrategicallycategoricallyfrighteninglynitroglycerineverlastinglyoveranalyzinggrammaticallyinfuriatinglydistressinglyenergeticallyunremittinglydisparaginglysynchronisinghyperglycemicendocrinologyunrelentinglytypographicalsynchronizingdisgracefullygeometricallycrystallizingmagisteriallyunoriginalityhydrogenationoverbearinglyunforgivinglymyoglobinurianightmarishlygeostationaryinterrogatoryproselytizing
...View all with 13 letters...
Phrases (139)
harvey cushingvaginal arterygilbert murrayproperty rightpraying mantidradiant energysalivary glandgenus cyprinusgenus martyniascoring system
...View all with 13 letters...
Words (260)
cinematographyoverwhelminglygeographicallynitroglycerineexcruciatinglyembarrassinglyentertaininglybiographicallyastrologicallydisapprovinglyhistoriographyoverpoweringlyimpregnabilitydepolymerizingthyroglobulinsgenerationallylightheartedlyinfrangibilitygeohydrologistheterozygositydiscouraginglyhypoallergenicinvigoratinglyupgradeabilitymyrmecologistscryobiologicalegocentricallyhyperpigmentedacceleratinglyantiregulatorysacrilegiouslynonhygroscopicexasperatinglypseudepigraphyhydrobiologies
...View all with 14 letters...
Phrases (145)
pituitary glandveliky novgorodigor stravinskydrainage systemoyster dressingturkey stuffingprogram libraryoyster stuffingright to libertykyrgyz republic
...View all with 14 letters...
Words (205)
chronologicallysynergisticallyoversimplifyingneurophysiologycytomegalovirusrecrystallizingdramaturgicallylogarithmicallytransmogrifyinggastronomicallygynandromorphiccorrespondinglydemographicallyheartbreakinglyinterrogativelyagranulocytosishyperimmunizingcommiseratinglyalgorithmicallyphysiographicalmarriageabilityretrogressivelynonbelligerencydishearteninglyhyperaggressiveradioautographydaguerreotypisthydrobiologicaluncopyrightableoverclassifyingnitroglycerineshypervigilancesgravimetricallyresystematizingtelegraphically
...View all with 15 letters...
Phrases (171)
syringa vulgarisbenefit of clergymount nyiragongomail-order buyinghyoscyamus nigerfamily triglidaedasyprocta agutiarachis hypogaeacantering rhythmstrategic buyout
...View all with 15 letters...
Words (89)
hyperintelligentuncompromisinglyphotographicallyparapsychologistparadigmaticallypornographicallyparamagneticallyradiographicallytrinitroglycerinotolaryngologisthypersensitizingmicrogametophytehyperstimulatingparapsychologieshyperventilatingphotolithographyarchaeologicallycriminologicallycrossopterygiansorganizationallyiconographicallycryptozoologistslyginopteridalesstenographicallycrystallographiclithographicallyflabbergastinglyflexographicallyflibbertigibbetystereoregularitydaguerreotypistsstrongyloidiasesstrongyloidiasispetrographicallylymphangiography
...View all with 16 letters...
Phrases (182)
italian greyhoundstrictly speakingchristian huygenscapital of hungarycardiac glycosidecygnus buccinatorcommercial agencyautogenic therapysugar ray robinsonisland of guernsey
...View all with 16 letters...
Words (56)
straightforwardlycounterinsurgencybacteriologicallyanthropologicallyneurophysiologistradiobiologicallyparapsychologistsparasitologicallyferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologylymphangiographiccytomegalovirusesconfigurationallypharmacologicallyelectronegativitystrongyloidosisesoceanographicallybibliographicallyzoogeographicallyphonocardiographytrigonometricallyhyperintelligencechromolithographyotolaryngologicalneurophysiologiesotolaryngologistsgynandromorphismselectromyographicneuropsychologiesneuropsychologistsuperheavyweightsmicrobiologically
...View all with 17 letters...
Phrases (174)
interstate highwaypearly everlastingantipsychotic drugcylindrical liningrepublic of hungaryfamily engraulidaegenus dactylorhizagreek monetary unitivy-leaved geraniumclimbing hydrangea
...View all with 17 letters...
Words (33)
hypercoagulabilityinterchangeabilityneuropsychologicalspectroheliographysphygmomanometrieslaryngopharyngitislymphangiographiesautobiographicallymagnetostrictivelygeochronologicallyneuroendocrinologyoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesisneurophysiologistselectromyographiesultracentrifugallyneuropsychologistsmetallographicallyelectrophysiologicpropagandisticallyrhinolaryngologistroentgenologicallyhydrometallurgicalpsychobiographicalhydrometallurgistshydrometeorologieshydrometeorologistindiscriminatinglydihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (185)
bombycilla garrulusrevolutionary groupfreudian psychologyafghan monetary unitfamily asparagaceaefulminating mercurygene delivery vectorsyzygium aromaticumarthur garfield haysgossypium herbaceum
...View all with 18 letters...
Words (22)
cinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallymagnetohydrodynamicchromatographicallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectrophysiologieselectrophysiologistelectroretinographycharacterologicallyhistoriographicallyhydrometeorologicalhydrometeorologistspsychopharmacologicphytogeographicallypaleogeographicallyelectrocardiographyPhrases (153)
alpine type of glaciergiles lytton stracheygenus symphoricarposbond-trading activitycapital of kyrgyzstanavogadro's hypothesishydrobates pelagicusuniversity of chicagounix operating systemghanian monetary unit
...View all with 19 letters...
Words (14)
polyphiloprogenitivecrystallographicallylymphogranulomatosisoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsroentgenographicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (110)
oryctolagus cuniculusbyelorussian languagemagnetic bubble memoryluscinia megarhynchosfamily gasterosteidaeunabridged dictionarymilitary intelligenceglycerol tripalmitateegyptian monetary unitaustralian bonytongue
...View all with 20 letters...
Words (8)
psychopharmacologicalotorhinolaryngologistotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistsPhrases (100)
igor ivanovich sikorskybulgarian monetary unithungarian monetary unitextrauterine pregnancyginglymostoma cirratumnorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaardsamuel taylor coleridge
...View all with 21 letters...
Words (3)
otorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyPhrases (79)
high-density lipoproteinguatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitamygdalus communis amaraguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleynotemigonus crysoleucasedward kennedy ellington
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (54)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationfederal republic of germanyandrei andreyevich gromykoposterior meningeal artery
...View all with 24 letters...
Phrases (26)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyreligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigades
...View all with 25 letters...
Phrases (30)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricumbenign prostatic hyperplasia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (27)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (11)
great smoky mountains national parkdiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityhuygens' principle of superpositionnorth atlantic treaty organizationdefense information systems agency
...View all with 31 letters...
Phrases (12)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusnonsteroidal anti-inflammatory drugprimary subtractive colour for lightlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
