Words Containing: G,I,N,Y
(In Any Order)
There are 4,403 words,
2,178 phrases and
0 abbr's with
G,I,N,Y in.
Best Scoring Words With: G,I,N,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| cozying | 7 | 22 | verb, adjectivev, adj | |||||
noun • a padded cloth covering to keep a teapot warm adjective satellite • enjoying or affording comforting warmth and shelter especially in a small space • having or fostering a warm or friendly and informal atmosphere • suggesting connivance | ||||||||
| lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| yakking | 7 | 19 | verb, adverbv, adv | |||||
noun • noisy talk • large long-haired wild ox of Tibet often domesticated verb • talk profusely | ||||||||
| yukking | 7 | 19 | verb, nounv, n | |||||
verb • To laugh exuberantly. | ||||||||
| zingy | 5 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jurying | 7 | 18 | verb, nounv, n | |||||
verb • To judge by means of a jury. | ||||||||
| kything | 7 | 18 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| taxying | 7 | 18 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| jingly | 6 | 17 | adverb, adjectiveadv, adj | |||||
adjective satellite • having a series of high-pitched ringing sounds like many small bells | ||||||||
| vyingly | 7 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (230)
playingstayingyellingdignitydenyingburyinghygienecopyingsyringeyappingrelyingcyclingwyomingnightlyyawningtidyingyelpingstylingundyingslayingangrilymagnifyvaryingyakkingsignifypityingrhymingyippingstringydignifyuntyingspringyenvyinggyppingstygian
...View all with 7 letters...
Phrases (2)
tying upkey ringWords (378)
anythingstudyingcarryingmarryingannoyingworryingegyptianpartyingapplyingbullyingimplyingyearninglovinglyhurryingsprayingstingrayhygienicemptyingsyringeslobbyingyodelingrallyingunifyingyieldingstrayinglynchingjokinglyoutlyingdallyingrelayingdirtyingdizzyingmisogynyedifyingfancying
...View all with 8 letters...
Phrases (7)
sign awaydrying upbig moneyby designlaying ongin rummytrying onWords (635)
virginityimaginaryintegrityamazinglywillinglygenuinelyseeminglyrecyclinganalyzingwhinnyinghemingwaysmilinglysupplyinggymnasiumingenuityknowinglylongevityplaythinganalysingpurifyingverifyingshimmyingskydivingunsightlycryogeniceasygoingsurveyinghygienistmockinglyindignitynotifyingscurryingdignitaryglycerinevaryingly
...View all with 9 letters...
Phrases (21)
ground ivygin rickeyegg layingnot guiltyyoung birdyoung fishyoung girleasy goingflying foxboxing day
...View all with 9 letters...
Words (742)
everythingoriginallyterrifyinggenerositysatisfyinggymnasticshorrifyingtestifyingunderlyingmagnifyingqualifyingnegativitygratifyingnegativelydiligentlyshockinglyinsurgencyjustifyingmisogynistneighborlyscathinglyportrayingsignifyingstunninglyunyieldingcharminglyclarifyingdiagonallyswimminglysingularlyfalsifyingannoyinglymystifyingoverpayingdynamiting
...View all with 10 letters...
Phrases (47)
energy unitdry wallingwedding daytight moneyhanging flypaying backfading awaybing crosbyglycine maxworking day
...View all with 10 letters...
Words (677)
geneticallyaccordinglybabysittingdaydreamingsovereigntyidentifyingcontingencyexceedinglyunwittinglyunknowinglyoriginalityterminologysingularitymultiplyingiconographyunwillinglycriminologyorganicallysymbolizinglingonberryscientologyinteragencyyugoslavianhypnotizingappallinglyplaywritingtypewritingangelicallystultifyingsimplifyingdehydratingantigravityphysiognomyornithologyquantifying
...View all with 11 letters...
Phrases (97)
genus myxinelaying claimlaying wastebulb syringesingle entryplaying areadry cleaningrunning playafrican greyhydrogen ion
...View all with 11 letters...
Words (551)
increasinglysurprisinglyaccompanyinggynecologiststorytellingconvincinglydisgustinglyelectrifyingunsatisfyingmisogynisticrefreshinglytrigonometrybodybuildingunimaginablydisturbinglycongenialityterrifyinglycompellinglybelligerencyphylogeneticungraciouslybegrudginglystaggeringlystereotypingintensifyingenchantinglyincorrigiblymagneticallydepressinglydespairinglyresoundinglyhygienicallydiversifyinghypogonadismintelligibly
...View all with 12 letters...
Phrases (136)
staying powerbody stockinggenus glycineshaking palsygenus syringainquiry agentstring theorygenus cydoniasign industrypolicy change
...View all with 12 letters...
Words (424)
significantlyinterestinglygynaecologistintelligentlyfrighteninglymagnificentlyastonishinglynitroglycerineverlastinglypainstakinglyoveranalyzingbiotechnologyinfuriatinglydistressinglyenergeticallygynecologicalunflinchinglyunremittinglydisparaginglydeoxygenationsynchronisinghumiliatinglyendocrinologyunrelentinglymeaninglesslysynchronizingquestioninglycrystallizingphysostigmineignominiouslyhypothesisingfascinatinglyunoriginalityhydrogenationoverbearingly
...View all with 13 letters...
Phrases (172)
harvey cushingvaginal arteryhigh-and-mightydwindling awaydizygotic twinpraying mantidradiant energygenus acinonyxsalivary glandgenus cyprinus
...View all with 13 letters...
Words (274)
cinematographyoverwhelminglycytogeneticistnitroglycerineexcruciatinglygynaecologicalembarrassinglylinguisticallyunintelligiblyunconvincinglyentertaininglydiagnosticallyunsuspectinglyanesthesiologydisapprovinglyunhesitatinglyethnologicallyoverpoweringlymagniloquentlyimpregnabilitydisingenuouslythymectomizingdepolymerizingthyroglobulinsgenerationallyinsignificancyinfrangibilitydiscouraginglydisquantityinghypoallergenicinvigoratinglygenealogicallyegocentricallyhyperpigmentedintimidatingly
...View all with 14 letters...
Phrases (184)
pituitary glandhigh technologyveliky novgorodigor stravinskygenus gossypiumgenus syngoniumdrainage systemoyster dressingturkey stuffingoyster stuffing
...View all with 14 letters...
Words (204)
technologicallyanaesthesiologychronologicallysynergisticallyoversimplifyingcondescendinglydisappointinglyneurophysiologyrecrystallizingtransmogrifyinggastronomicallyunquestioninglygynandromorphiccorrespondinglyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitysidesplittinglyhyperimmunizingcommiseratinglypsychoanalyzingunintelligentlydisenchantinglynonbelligerencydishearteninglynonbiologicallyphytopathogenicintelligibilitydistinguishablyuncopyrightableoverclassifyingnitroglycerineshypervigilances
...View all with 15 letters...
Phrases (207)
syringa vulgarisbenefit of clergyasamiya languagemount nyiragongomail-order buyinggenus sylvilagusgenus bombycillahyoscyamus nigergenus cyanocittacantering rhythm
...View all with 15 letters...
Words (69)
hyperintelligentphylogeneticallyuncompromisinglyunapologeticallyinextinguishablypornographicallyparamagneticallytrinitroglycerinotolaryngologisthypersensitizinghyperstimulatinghyperventilatingnonpsychologicalhemoglobinopathycriminologicallycrossopterygiansorganizationallyiconographicallylyginopteridalesstenographicallyhypopigmentationflabbergastinglynonsignificantlyindefatigabilitycytotechnologiescytotechnologiststrongyloidiasesstrongyloidiasislymphangiectasialymphangiectasislymphangiographyconsanguineouslyoligodendrocytesimmunohematologygeneralizability
...View all with 16 letters...
Phrases (197)
italian greyhoundstrictly speakingchristian huygenscapital of hungarycygnus buccinatorcommercial agencyalan lloyd hodgkindwight lyman moodyautogenic therapysugar ray robinson
...View all with 16 letters...
Words (42)
counterinsurgencyanthropologicallyneurophysiologistpsycholinguisticsunexchangeabilityferrimagneticallymorphogeneticallymicropaleontologylymphangiographiccytopathogenicityconfigurationallycytotechnologistsimmunogeneticallyelectronegativitystrongyloidosisesoceanographicallysamoyedic-speakingphonocardiographyglycosaminoglycantrigonometricallyhyperintelligenceunintelligibilityotolaryngologicalneurophysiologiesotolaryngologistsdisadvantageouslygynandromorphismsneuropsychologiesneuropsychologistangiocardiographyhyperpigmentationdephosphorylatinguncomprehendinglyphotosynthesizingphototypesettings
...View all with 17 letters...
Phrases (184)
hypoglycemic agentinterstate highwaypearly everlastingmalaysian languageantipsychotic drugcylindrical liningrepublic of hungarytypha angustifoliayeniseian languagefamily engraulidae
...View all with 17 letters...
Words (27)
interchangeabilityneuropsychologicalsphygmomanometrieshypophysectomizinglaryngopharyngitislymphangiographiesdistinguishabilitymagnetostrictivelyphenomenologicallygeochronologicallyneuroendocrinologyglycosaminoglycansgranulocytopoiesesgranulocytopoiesisneurophysiologistsultracentrifugallyneuropsychologistsdemythologizationspropagandisticallyrhinolaryngologistroentgenologicallysedimentologicallyindiscriminatinglyphytohemagglutinindihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (193)
revolutionary groupfreudian psychologyafghan monetary unitnavigational systemantipsychotic agentgenus chamaecytisusfulminating mercuryfamily magnoliaceaegene delivery vectorwedding anniversary
...View all with 18 letters...
Words (14)
cinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallycytopathogenicitiesmagnetohydrodynamicdehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectroretinographyphytohemagglutininssociolinguisticallyPhrases (149)
building supply housejohn millington syngefamily cynoglossidaealpine type of glaciergiles lytton stracheygenus symphoricarposbond-trading activitycapital of kyrgyzstansalicylate poisoninguniversity of chicago
...View all with 19 letters...
Words (9)
polyphiloprogenitiveindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicsroentgenographicallysyncategorematicallyPhrases (116)
oryctolagus cuniculusbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosunabridged dictionarymilitary intelligenceegyptian monetary unitfamily gleicheniaceaeaustralian bonytongue
...View all with 20 letters...
Words (6)
hypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologiesdendrochronologicallyantiferromagneticallyclinicopathologicallyPhrases (88)
igor ivanovich sikorskybulgarian monetary unithungarian monetary unitextrauterine pregnancycynoglossum officinaleginglymostoma cirratumnorwegian monetary unitstrawberry haemangiomasoren aabye kierkegaardspeech intelligibility
...View all with 21 letters...
Words (2)
otorhinolaryngologicalotorhinolaryngologistsPhrases (86)
high-density lipoproteinguatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitamygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellington
...View all with 22 letters...
Words (1)
laryngotracheobronchitisPhrases (52)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationfederal republic of germanyandrei andreyevich gromyko
...View all with 24 letters...
Phrases (28)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngereligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigades
...View all with 25 letters...
Phrases (26)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (23)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (18)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianussingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormone
...View all with 28 letters...
Phrases (11)
great smoky mountains national parkdigital communications technologyrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planninghuygens' principle of superpositionnorth atlantic treaty organizationdefense information systems agency
...View all with 31 letters...
Phrases (10)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory druglymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united statesbosnian-herzegovinian monetary unitcystic fibrosis transport regulatorPhrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
