Words Containing: G,A,C,Y
(In Any Order)
There are 1,663 words,
1,453 phrases and
0 abbr's with
G,A,C,Y in.
Best Scoring Words With: G,A,C,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| coxalgy | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| yacking | 7 | 17 | verb, nounv, n | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
| cabbagy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| cogways | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cogway | 6 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
| myalgic | 7 | 15 | adjectiveadj | |||||
adjective • of or relating to myalgia | ||||||||
| scraggy | 7 | 14 | noun, adjectiven, adj | |||||
adjective satellite • being very thin • having a sharply uneven surface or outline | ||||||||
| craggy | 6 | 13 | adjectiveadj | |||||
adjective satellite • having hills and crags | ||||||||
| glycans | 7 | 13 | ||||||
noun • (cabrohydrate) Any polysaccharide or oligosaccharide, especially one that is part of a glycoprotein or glycolipid. | ||||||||
| claying | 7 | 13 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
cagyWords (55)
carryingcategoryvagrancyfancyingyachtingscragglygeomancyachinglylychgatecaddyinggarlickysagacitygramercydelegacygynarchycraggilygauchelyelegancycottageysyngamicdecayingregnancygynaeceagynaeciaspagyriccandyinggynoeciamegacitycyanogengraybackcabbageycoagencyfugacityaglyconeaglycons
...View all with 8 letters...
Phrases (6)
un agencymagic eyegypsy cabcandy eggguy cablead agencyWords (116)
pregnancymagicallylogicallypiggybackclergymanoligarchygymnasticscallywagpacifyingzygomaticgunnysackpanegyricpugnacityarrogancyglaciallypoignancyscatologycyanidingstagnancygracilitycoaxinglyplangencyphagocytefragrancylogomachybracinglycoccygealgynaeciumcarpologygynarchicscraggilydichogamymycophagysubagencyacylating
...View all with 9 letters...
Phrases (11)
cary grantgunny sackcrazy gluemargay catchen n. yanggray birchclary sagefly agaricflying catacyl group
...View all with 9 letters...
Words (166)
gymnasticstragicallygracefullyarcheologygraciouslysurgicallylegitimacyscathinglycharminglycardiologyclarifyingcryptogramprofligacymenacinglymalignancyhypnagogiccatalyzingplayactingdegeneracycoprophagyexactinglycrashinglyescapologymagistracyechographyoceanologybenignancycyanogenicanaglyphiclogicalityzygomaticscognizablygraywackesgothicallyglancingly
...View all with 10 letters...
Phrases (32)
genus cycassugar candypaying backglycine maxglyptic artgrace kellygenus caryafree agencygrainy clubhockey game
...View all with 10 letters...
Words (207)
geneticallyaccordinglycalligraphyarchaeologyiconographyorganicallygastrectomyinteragencyangelicallycarriagewaygeophysicalgraphicallyhypogastriccopycattingchorographyclimatologyunceasinglyclassifyingtypographicgynaecologygastroscopybricklayingcartographycryptographsuperagencytragicomedytypecastinggenericallyscenographyscreaminglyillogicallyeschatologysubcategorysagaciouslymycophagist
...View all with 11 letters...
Phrases (45)
genus lycosalaying claimdry cleaningafrican greygrand canyonroyal agaricscurvy grassgandy dancercity managerspace agency
...View all with 11 letters...
Words (246)
increasinglyaccompanyingchoreographymythologicalbiologicallycourageouslypharmacologycongenialityecologicallyoceanographyungraciouslycryptographyenchantinglymagneticallygeologicallylogisticallyhygienicallyhypoglycemialaryngoscopehydrographicillegitimacystylographicetymologicalcardiomegalycontagiouslylaryngoscopyhydrologicaldogmaticallyconveyancingcongenitallyrecognizablycardiographyextravagancycyanogeneticcryptogamous
...View all with 12 letters...
Phrases (56)
hockey leaguebaby carriagegenus cydoniapolicy changegenus halcyonacid hydrogengrand larcenygenus eucaryacasey stengelcyanide group
...View all with 12 letters...
Words (235)
psychologicalsignificantlyphysiologicalgynaecologiststrategicallycategoricallymagnificentlyideologicallygrammaticallyhypoglycaemicenergeticallygynecologicalcryptographertypographicaldisgracefullygeometricallycrystallizingtheologicallyfascinatinglynostalgicallypalynologicaldactylographyconsanguinityallegoricallypragmaticallypedagogicallyegotisticallyenigmaticallycryptologicallethargicallychangeabilityphagocytizingreproachinglyphagocytosingvacillatingly
...View all with 13 letters...
Phrases (79)
harvey cushingadvocacy groupcygnus atratusclyde tombaughgenus cyclamencedar mahoganygenus acinonyxgenus dactyliscatalog buyinggustatory cell
...View all with 13 letters...
Words (219)
cinematographygeographicallynanotechnologypathologicallycongratulatoryexcruciatinglyparapsychologycharacterologygynaecologicallinguisticallysociologicallyelectromyogrambiographicallydiagnosticallyastrologicallychromatographyetymologicallyethnologicallyinsignificancydiscouraginglyhypoallergenicgenealogicallycryobiologicalegocentricallyacceleratinglygeopoliticallymisclassifyingsacrilegiouslycryptographersteleologicallyhypervigilanceichthyologicalichthyophagouseulogisticallyneurologically
...View all with 14 letters...
Phrases (103)
lachrymal glandtubal pregnancyemergency brakegenus chrysaoragenus aepycerosanser cygnoidespac-man strategyegyptian cottoncape gooseberryfagus sylvatica
...View all with 14 letters...
Words (169)
psychologicallytechnologicallyphysiologicallychronologicallysynergisticallycytomegalovirusrecrystallizingencephalographydramaturgicallylogarithmicallygastronomicallycrystallographyseismologicallygynandromorphicpsychopathologydemographicallyaccommodatinglyagranulocytosisunchangeabilitycommiseratinglyalgorithmicallyphysiographicalpsychoanalyzingdisenchantinglynonbiologicallyphytopathogenichydrobiologicaluncopyrightablehypercoagulableoverclassifyingsyllogisticallyhypervigilancesgravimetricallyelectromyogramsuncomplainingly
...View all with 15 letters...
Phrases (118)
genus bombycillahyoscyamus nigerdasyprocta agutigenus cyanocittaarachis hypogaeacantering rhythmstrategic buyoutmask of pregnancyspecific gravityafrican mahogany
...View all with 15 letters...
Words (78)
phylogeneticallyelectromyographyunapologeticallypsychobiologicalphotographicallyparapsychologistparadigmaticallypornographicallyparamagneticallyradiographicallymicrogametophyteparapsychologiesnonpsychologicalarchaeologicallypathophysiologiccriminologicallycrossopterygiansichthyologicallyiconographicallyrechromatographystenographicallycrystallographiclithographicallynonsignificantlyflexographicallyprotoarchaeologymacrophotographylymphangiectasialymphangiectasispetrographicallyconsanguineouslyecophysiologicalechocardiographyorganolepticallysyncategorematic
...View all with 16 letters...
Phrases (133)
strictly speakingchristian huygenscapital of hungarycardiac glycosidecygnus buccinatorgenus crotaphytusbluegrass countrycommercial agencyautogenic therapycalystegia sepium
...View all with 16 letters...
Words (57)
bacteriologicallyanthropologicallyradiobiologicallyunexchangeabilityparapsychologistsparasitologicallyferrimagneticallymorphogeneticallylexicographicallycrystallographerscrystallographiesmicropaleontologylymphangiographiccytomegalovirusescytopathogenicityconfigurationallypharmacologicallyimmunogeneticallyelectronegativityoceanographicallybibliographicallyzoogeographicallysamoyedic-speakingphonocardiographyglycosaminoglycantrigonometricallychromolithographyneuropharmacologyotolaryngologicalphosphoglycerateselectrometallurgyelectromyographicmetapsychologicalmicrobiologicallyangiocardiography
...View all with 17 letters...
Phrases (141)
hypoglycemic agentcoccygeal vertebratheological systemantipsychotic drugcylindrical liningrepublic of hungarycrataegus monogynagenus chlamyphorusindependent agencygenus dactylorhiza
...View all with 17 letters...
Words (34)
hypercoagulabilitypsychopharmacologypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalspectroheliographypathophysiologicalautobiographicallymagnetostrictivelyphenomenologicallyophthalmologicallygeochronologicallyglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesiselectromyographiesultracentrifugallymetallographicallyelectrooculographyelectrophotographypropagandisticallyroentgenologicallyhistophysiologicalcryptogrammataceaehydrometallurgicalpsychobiographicalsedimentologicallyphysiopathologicalindiscriminatinglypsychopathologistsneurophysiologicalPhrases (163)
bombycilla garrulusfreudian psychologygenus styracosaurusfamily asparagaceaeantipsychotic agentmegacycle per secondfamily polygalaceaegenus chamaecytisusfulminating mercuryfamily magnoliaceae
...View all with 18 letters...
Words (23)
psychophysiologicalcinematographicallyextralinguisticallyparthenogeneticallycrosslinguisticallycytopathogenicitiesmagnetohydrodynamicchromatographicallyechoencephalographydehydrochlorinatingelectromagneticallycross-linguisticallyelectroretinographycharacterologicallyhistopathologicallyhistoriographicallyhydrometeorologicalpsychopharmacologicsymptomatologicallyphytogeographicallysociolinguisticallypaleogeographicallyelectrocardiographyPhrases (104)
family cynoglossidaealpine type of glaciergiles lytton stracheygenus cryptobranchusgenus symphoricarposbond-trading activitycapital of kyrgyzstansalicylate poisoninghydrobates pelagicusuniversity of chicago
...View all with 19 letters...
Words (13)
crystallographicallymagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalroentgenographicallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (101)
oryctolagus cuniculusclyde william tombaughmagnetic bubble memoryclassifying adjectiveluscinia megarhynchosa-scan ultrasonographyunabridged dictionarymilitary intelligencelaw enforcement agencyglycerol tripalmitate
...View all with 20 letters...
Words (9)
psychopharmacologicalphosphoglyceraldehydeelectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychophysiologicallyclinicopathologicallyPhrases (63)
igor ivanovich sikorskyextrauterine pregnancycynoglossum officinaleginglymostoma cirratumcucurbita argyrospermasamuel taylor coleridgeagricultural chemistryfamily myrmecophagidaefamily grossulariaceaecongenital abnormality
...View all with 21 letters...
Words (4)
electroencephalographyphosphoglyceraldehydesotorhinolaryngologicalelectrophysiologicallyPhrases (64)
nicaraguan monetary unitamygdalus communis amaradisplaying incompetencedoctor of sacred theologynotemigonus crysoleucassubclass crossopterygiigymnogyps californianusharvery williams cushingmary ludwig hays mccauleygenus eleutherodactylus
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (40)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinsir terence mervyn rattigantechnology administrationfederal republic of germanyandrei andreyevich gromykosubdivision mastigomycotaconstitutional psychologyelectromagnetic delay line
...View all with 24 letters...
Phrases (17)
igor fyodorovich stravinskyfrancis scott key fitzgeraldcentral intelligence agencyreticular activating systemcygnus columbianus bewickiidevelopmentally challengedsuperorder acanthopterygiimargaret munnerlyn mitchellmercury-in-glass thermometerlaw of conservation of energy
...View all with 25 letters...
Phrases (20)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinassyrian neo-aramaic languagesubdivision mastigomycotinaentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizanscircumflex artery of the thighcalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (20)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkoinformation processing system
...View all with 27 letters...
Phrases (12)
ephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianushypothalamic releasing hormonecentral intelligence machinerymilitary intelligence section 5military intelligence section 6melanocyte-stimulating hormone
...View all with 28 letters...
Phrases (10)
digital communications technologyport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activitynorth atlantic treaty organizationdefense information systems agencymary godwin wollstonecraft shelleyPhrases (10)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusprimary subtractive colour for lightoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisfederal emergency management agencycystic fibrosis transport regulatorPhrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
