Words Containing: EPTI
(In Exact Order)
There are 373 words,
67 phrases and
0 abbr's with
EPTI in.
Best Scoring Words With: EPTI
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| peptize | 7 | 20 | verbv | |||||
verb • disperse in a medium into a colloidal state | ||||||||
| skeptic | 7 | 15 | noun, adjectiven, adj | |||||
noun • someone who habitually doubts accepted beliefs | ||||||||
| sceptic | 7 | 13 | nounn | |||||
noun • someone who habitually doubts accepted beliefs | ||||||||
| peptics | 7 | 13 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| peptide | 7 | 12 | nounn | |||||
noun • amide combining the amino group of one amino acid with the carboxyl group of another; usually obtained by partial hydrolysis of protein | ||||||||
| peptic | 6 | 12 | adjectiveadj | |||||
adjective • relating to or promoting digestion | ||||||||
| peptids | 7 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| aseptic | 7 | 11 | adjectiveadj | |||||
adjective satellite • free of or using methods to keep free of pathological microorganisms | ||||||||
| septime | 7 | 11 | nounn | |||||
noun • The seventh defensive position, with the sword hand held at waist height, and the tip of the sword at knee level. | ||||||||
| peptid | 6 | 11 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (35)
receptionexceptionacceptingdeceptionepilepticskepticaldeceptivereceptivescepticalinceptionreptilianexceptingdyspepticanalepticacceptivepeptidaseinceptiveinceptingpeptizingdipeptideprolepticsyllepticexceptivecathepticreptiliumsepticitypeptizerspeptisersseptiformseptimolepeptisingpepticityreptiloidobreptionsheep-tickWords (47)
perceptionconceptionperceptiveantisepticskepticismsepticemiasepticemicscepticismcatalepticineptitudeconceptivepeptidasesdisceptinginceptionsdeceptionsprotrepticsusceptiveinceptivesreceptionsdipeptidespreceptivedyspepticssubreptionseptillionexceptionsreptiliansanalepticssepticidalepilepticsdeceptiousexceptiousasepticizepreceptialpeptisableobreptions
...View all with 10 letters...
Phrases (1)
septic tankWords (63)
exceptionalsusceptiblenarcolepticdeceptivelyperceptiblescepticallyskepticallyreceptivitysepticaemiapolypeptideperceptiblyneurolepticconceptionsreceptivelydipeptidasesepticemiasskepticismsunreceptiveperceptionsacceptinglyscepticismscatalepticsseptillionssepticitiesineptitudesasepticallydeceptionalprotrepticsoctapeptidenociceptivemucopeptidesubreptionssusceptiblyinceptivelyreaccepting
...View all with 11 letters...
Phrases (2)
peptic ulcerpeptide bondWords (49)
receptionistinterceptionunperceptiveperceptivelyapperceptionperceptivityepileptiformpolypeptidicnondeceptivenympholepticorganolepticdipeptidasesoctapeptidespolypeptidesmucopeptidespentapeptideglycopeptidenarcolepticsinterceptingexopeptidaseapperceptiveimperceptiveneurolepticsperceptionalneuropeptideconceptionalsusceptivityreconceptionimperceptionsepticidallypeptizationsoligopeptideacatalepticsasepticisingpeptisations
...View all with 12 letters...
Phrases (1)
reptile genusWords (55)
exceptionallymisconceptioncontraceptioncontraceptiveimperceptiblyimperceptiblepreconceptionsurreptitiousmisperceptionunexceptionaldeceptivenessinsusceptibleantiepilepticreceptivenessdyspepticallysubreptitiousacceptingnessendopeptidaseexteroceptiveneuropeptidesapperceptionsreconceptionspentapeptidespeptidoglycanexceptionablyunsusceptibleglycopeptidesprolepticallyexceptionableepilepticallyinsusceptiblyinterceptionsreceptivitiesexopeptidasespostepileptic
...View all with 13 letters...
Phrases (8)
class reptiliatake exceptionflying reptilereception deskreception lineage of reptilesreptile familyreception roomWords (36)
susceptibilityperceptivenessproprioceptivechemoreceptiveexceptionalityantisepticallysusceptivenessmisperceptionsperceptibilitychemoreceptionexceptionalismphotoreceptivecatalepticallyendopeptidasesmisconceptionsantiepilepticsproprioceptioncontraceptivesperceptivitiesphotoreceptionaminopeptidasepostconceptionpeptidoglycanssusceptivitiesfibrinopeptidepreconceptionscontraceptionsimperceptivityantisepticisesantisepticizedinsusceptivelyantisepticizesacceptilationsimperceptivelyantisepticised
...View all with 14 letters...
Phrases (3)
anapsid reptilepeptide linkagediapsid reptileWords (26)
intussusceptionsurreptitiouslysusceptiblenessdeceptivenessesexceptionalnessaminopeptidasesexceptionalismsfibrinopeptidessubreptitiouslyreceptivenessesintussusceptingintussusceptivephotoreceptionsacceptingnessesproprioceptionschemoreceptionsunexceptionableunexceptionablyreceptibilitiesunexceptionallyintrosusceptionantisepticisingskepticalnessesantisepticizinggraviperceptiondeceptibilitiesPhrases (5)
sound perceptionsynapsid reptileneuroleptic drugtouch perceptiontaste perceptionWords (17)
imperceptibilityimperceptivenessintussusceptionsorganolepticallyunsusceptibilitymechanoreceptionperceptibilitiessusceptivenessesexceptionabilityperceptivenessesunperceptivenessexceptionalitieshypersusceptibleinsusceptibilitymechanoreceptivesusceptibilitiescarboxypeptidasePhrases (12)
epileptic seizureneuroleptic agentvisual perceptionwedding receptionchelonian reptileseptic sore throatthecodont reptilepeptic ulcerationreceptive aphasiasepticemic plague
...View all with 16 letters...
