11-Letter Words Containing: EPTI
(In Exact Order)
There are 63 11 letter words,
2 11 letter phrases and
0 11 letter abbr's with
EPTI in.
Best Scoring 11 Letter Words With: EPTI
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
exceptional | 11 | 22 | adjectiveadj | |||||
adjective satellite • far beyond what is usual in magnitude or degree • surpassing what is common or usual or expected • deviating widely from a norm of physical or mental ability; used especially of children below normal in intelligence | ||||||||
deceptively | 11 | 22 | adverb, adjectiveadv, adj | |||||
adverb • in a misleading way | ||||||||
skeptically | 11 | 22 | adverbadv | |||||
adverb • with scepticism; in a sceptical manner | ||||||||
perceptibly | 11 | 22 | adverbadv | |||||
adverb • in a noticeable manner | ||||||||
receptivity | 11 | 21 | nounn | |||||
noun • willingness or readiness to receive (especially impressions or ideas) | ||||||||
polypeptide | 11 | 21 | nounn | |||||
noun • a peptide containing 10 to more than 100 amino acids | ||||||||
skepticisms | 11 | 21 | nounn | |||||
noun • doubt about the truth of something • the disbelief in any claims of ultimate knowledge | ||||||||
receptively | 11 | 21 | adverb, adjectiveadv, adj | |||||
adverb • in a receptive manner | ||||||||
acceptingly | 11 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
inceptively | 11 | 21 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words With EPTI In Order
Words (63)
exceptionalsusceptiblenarcolepticdeceptivelyperceptibleskepticallyscepticallysepticaemiareceptivitypolypeptideneurolepticperceptiblyperceptionsconceptionsdipeptidaseskepticismsreceptivelyunreceptivesepticemiasmucopeptideasepticallysepticitiessusceptiblyoctapeptideacceptinglyscepticismsnociceptiveinceptivelyprotrepticsineptitudesantisepticsreacceptingcatalepticsseptillionsdeceptionalsubreptionsacatalepticreptilianlyasepticizedseptivalentpeptisationeupepticityprolepticalasepticisedasepticizesseptiferousconceptiouspeptizationdyspepticalsyllepticalparablepticacceptivityasepticisessepticaemicbradypepticseptifragalcorreptionssubceptionsepanalepticpepticitiesasepticismsepilepticalirreceptivePhrases (2)
peptic ulcerpeptide bond