Words Containing: E,I,R,T,T,Y
(In Any Order)
There are 1,240 words,
1,756 phrases and
0 abbr's with
E,I,R,T,T,Y in.
Best Scoring Words With: E,I,R,T,T,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jittery | 7 | 17 | adjectiveadj | |||||
adjective • characterized by jerky movements adjective satellite • being in a tense state | ||||||||
tritely | 7 | 10 | adverb, adjectiveadv, adj | |||||
adverb • in a trite manner | ||||||||
littery | 7 | 10 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (40)
territoryintegritycertaintymaternityfertilitypaternityposteritydexteritynotorietydentistrysterilityausterityprettyingextremityintercitytypewritestitcheryytterbiumaltimetrytrinketryytterbiasretestifybrittlelyerythritetermitaryprettyishtinkertoyyatteringextralityverticitytrimethyltenebritytasimetryentryiststridymite
...View all with 9 letters...
Phrases (1)
petit juryWords (74)
babysittercreativityfraternitytypewriterrelativitystationeryneutralityperpetuitystridentlycontritelyexcitatoryliteratelytrotskyitereactivitytuberosityquaternitybaptisteryrotativelyliteralityinterpartysyncretistytterbiumstypescriptpyrrhotitebotrytiseshystereticcentralityvitrectomycentricityerectilitytypewritesskywrittenerythritestryptaminetinkertoys
...View all with 10 letters...
Phrases (10)
tin pyritestroy weighttoy terriercity centercity centregive it a tryfatty livercity editorcity fatherdebit entryWords (144)
electricityuncertaintyinfertilitymaterialityretaliatorytypewritingintricatelyversatilityintrepiditytypewrittenventilatorystringentlyprematurityterminatoryprettifyingreceptivityretinopathyverticalityyesternightinteriorityresistivityantipyreticretributorystereotypicintegralityinternalitypertinacitytransientlysyncretistsiterativelytotteringlycontrarietyantipovertynutritivelyheterotypic
...View all with 11 letters...
Phrases (19)
heavy hittereternal citywalter mittylittle rhodykitty littervariety meatcentral cityamyl nitratebutter daisymerit system
...View all with 11 letters...
Words (155)
penitentiarystorytellingpersistentlytrigonometryeccentricitytheatricallystereotypingattractivelytetracyclinestreptomycinpermittivityrepetitivelyreflectivityelectrolyticsystematizersempiternityarticulatelyentreatinglyperceptivityexorbitantlycreditworthytolerabilityglitteringlyinveteratelynoteworthilyalterabilityrestrictedlyclatteringlydistractedlyretestifyingvituperatoryinterdictoryreticulatelytorrentiallyinterestedly
...View all with 12 letters...
Phrases (34)
string theorypoetic rhythmin perpetuitypetit larcenyfifty percentpoint of entrybattle of ivryjimmy stewarttraverse cityauditory tube
...View all with 12 letters...
Words (190)
theoreticallyinterestinglyinadvertentlystrategicallyalternativelystereotypicalhyperactivitymarketabilityinterlocutorythyroidectomytheatricalityunremittinglyconfraternityretroactivelyimpertinentlypretentiouslygeostationaryprecipitatelyinterrogatorythreateninglycreditabilityamitriptylinepenetratinglyambidexterityinstructivelypenetrabilityintegumentaryintemperatelyantifertilitydetrimentallyheterogeneityelectrotypingneurotoxicityretributivelyconcentricity
...View all with 13 letters...
Phrases (58)
direct antonymbitter hickoryinventory itemspiny anteaterprivate treatyproperty rightprime quantitycretan dittanylyrurus tetrixwriting system
...View all with 13 letters...
Words (187)
respectabilityinterplanetaryterritorialityhyperventilateintermittentlypredictabilityclitoridectomynephrotoxicityconstructivelyconvertibilityinheritabilityintermediatelyentertaininglyinterferometryhydrotherapistdirectionalitybioelectricityextortionatelyunalterabilitystretchabilityinarticulatelycontributivelyhyperkeratoticindestructiblythyrotoxicoseslightheartedlyheterozygosityextemporaneityarithmeticallyinalterabilityweatherabilityantiregulatorypresentabilityperceptibilityspermatophytic
...View all with 14 letters...
Phrases (74)
admiralty metalabstract entitymoral certaintydata encryptionparts inventoryturkey stuffingoyster stuffingright to libertyutility routineidentity crisis
...View all with 14 letters...
Words (164)
internationallypsychotherapistphysiotherapistheterosexualitysurreptitiouslyparentheticallyplenipotentiaryproportionatelytherapeuticallyinstrumentalitystereochemistrypostoperativelyintrospectivelyuninterruptedlydemonstrativelyirresistibilityauthoritativelyarchitecturallyretrospectivelyinterrogativelyoxytetracyclinedemonstrabilitycentrosymmetricinteruniversitythyroidectomiesteletypewriterscomplementaritymerchantabilityinterculturallyautotetraploidyperipateticallysuperplasticityhyperstimulatedhyperstimulatesdaguerreotypist
...View all with 15 letters...
Phrases (97)
alimentary pasteprivate propertyrhythmic patterncantering rhythmstrategic buyoutmaternal qualitytietze's syndromemythical monsterturkey drumstickbrittany spaniel
...View all with 15 letters...
Words (87)
triphenylmethanehyperintelligentunpredictabilityhyperventilationimperceptibilityerythroblastosisthermostaticallyincontrovertiblythrombocytopeniaelectrochemistryhypersensitivityexterritorialitythermometricallytrinitroglycerinmicrogametophytethermoplasticityhyperstimulatinghyperstimulationadministrativelyimperfectibilityparasympatheticshyperventilatingthrombocytopenicthyroidectomizedferroelectricitymulticellularityflibbertigibbetystereoregularitycytophotometriesrelativisticallypiezoelectricitydaguerreotypistsimperturbabilityunrespectabilitychytridiomycetes
...View all with 16 letters...
Phrases (120)
strictly speakingvariable quantityrelative majoritycommercial treatyautogenic therapythai monetary unitmythical creaturerelay transmitterout of the ordinarypolitical liberty
...View all with 16 letters...
Words (66)
superconductivityparathyroidectomymaterialisticallyelectrostaticallypsychotherapeuticantirevolutionaryhyperreactivitiesself-contradictoryphysiotherapeuticthermoperiodicityhyperstimulationshyperventilationsthrombocytopeniaschlortetracyclinepaternalisticallyarchitectonicallyunderstandabilitycryptocrystallinepostrevolutionarydisrespectabilityhyperalimentationstereospecificitycounterfactualityrecrystallizationtrichloroethyleneelectronegativityinteravailabilityelectroanalyticaltridimensionalityindestructibilitytrigonometricallyorthopsychiatriestriiodothyroninestriphenylmethanesturbidimetrically
...View all with 17 letters...
Phrases (143)
czech monetary unitproteolytic enzymecuban monetary unitinterstate highwayotto fritz meyerhofpetasites hybridushereditary patternpython reticulatusuniversity studentevolutionary trend
...View all with 17 letters...
Words (35)
characteristicallydisproportionatelyinterchangeabilitypolyesterificationhypersensitivitieshypersensitizationpsychotherapeuticsanthropocentricitycalymmatobacteriumstoichiometricallypteridospermaphytarecrystallizationsdiethylstilbestrolcounterintuitivelymagnetostrictivelytrichloroethylenesrepresentationallyneuropsychiatristsultracentrifugallyultrarevolutionarychlortetracyclineshydroelectricitieshydrometallurgistshydrometeorologistoveroptimisticallycytoarchitectonicsintraventricularlyhydroxytryptamineshyperalimentationstetraiodothyroninehyperconcentrationdimethyltryptaminehypernationalistichyperpigmentationshyperrationalitiesPhrases (160)
administrative bodyposterior pituitaryafghan monetary unitmetric capacity unitcommercial activityshort-term liabilityyemeni monetary unitarchitectural stylevictory celebrationtreaty of versailles
...View all with 18 letters...
Words (40)
polyesterificationshypersensitizationsextralinguisticallyextraterritorialityhypersusceptibilityparathyroidectomiesparthenogeneticallynonrelativisticallycytodifferentiationimmunocytochemistrydiethylstilbesteroldiethylstilboestrolmercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelythird-dimensionalityinterferometricallythree-dimensionalityelectrophoreticallyelectrophysiologistanthropocentricallyelectroretinographyhydroxytetracyclinedihydrostreptomycinhydrometeorologistsparasympathomimeticincontrovertibilityoverproportionatelydiethylstilbestrolscounterinflationaryhyperconcentrationstetramethyldiarsinedimethylnitrosamine
...View all with 19 letters...
Phrases (170)
water-plantain familyitalian monetary unitlatvian monetary unitgiles lytton stracheyzairese monetary unitzambian monetary unitchinese monetary unitkuwaiti monetary unittheory of inheritancebritish monetary unit
...View all with 19 letters...
Words (15)
counterrevolutionaryuncharacteristicallyoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcytodifferentiationsacetylcholinesteraseelectrophysiologistsmicrocrystallinitiesimmunohistochemistrychemotherapeuticallymicrophotometricallysyncategorematicallydimethylnitrosaminesheterobasidiomycetesPhrases (155)
honduran monetary unitmalawian monetary unitlebanese monetary unitfamily trachipteridaedivision tracheophytahundred-and-forty-fifthsuricata tetradactylasouth american countryorder actinomycetalesjapanese monetary unit
...View all with 20 letters...
Words (7)
hypersusceptibilitiesimmunocytochemistriesacetylcholinesterasesintersubstitutabilityantiferromagneticallypsychotherapeuticallytetrahydrocannabinolsPhrases (131)
icelandic monetary unitelectrolytic condensermalaysian monetary unithelichrysum bracteatumbulgarian monetary unithungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecturetanzanian monetary unit
...View all with 21 letters...
Words (4)
spectrophotometricallyintercomprehensibilityhexamethylenetetraminemicrospectrophotometryPhrases (108)
venezuelan monetary unitredevelopment authoritymultiple mononeuropathyloyalist volunteer forcesodium tripolyphosphatehigh-density lipoproteinguatemalan monetary unitathyrium thelypteroidescrescent city connectionmale reproductive system
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (80)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitinterlocutory injunctionkyrgyzstani monetary unitbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitor
...View all with 23 letters...
Words (3)
laryngotracheobronchitishyperbetalipoproteinemiamicroelectrophoreticallyPhrases (65)
louis seymour bazett leakeysubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisantiarrhythmic medicationtechnology administration
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (62)
francis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskypolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonwestern samoan monetary unit
...View all with 25 letters...
Phrases (52)
hunting and gathering societysecretary of veterans affairsevelyn arthur saint john waughrevolutionary calendar monthnewton's theory of gravitationsubdivision deuteromycotinabureau of diplomatic securitysystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (39)
augustus welby northmore pugintricyclic antidepressant drugthyrotropin-releasing hormoneprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulusinformation processing systemtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (35)
revolutionary people's struggletriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencerevolutionary communist leagueface-amount certificate company
...View all with 28 letters...
Phrases (20)
acrylonitrile-butadiene-styreneantisocial personality disorderautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unitultrasonic pulse velocity testertheory of punctuated equilibrium
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthouseself-report personality inventorydepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentssevere acute respiratory syndromecalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (15)
great smoky mountains national parkfreedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencyfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (17)
hierarchical classification systemweakly interacting massive particlerevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (11)
nondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economypositron emission tomography scanner
...View all with 33 letters...
Phrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partysecurity intelligence review committeeunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
respiratory distress syndrome of the newborn