Words Containing: E,I,N,S,T,Y
(In Any Order)
There are 1,951 words,
2,022 phrases and
0 abbr's with
E,I,N,S,T,Y in.
Best Scoring Words With: E,I,N,S,T,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jitneys | 7 | 17 | nounn | |||||
noun • a vehicle carrying many passengers; used for public transport | ||||||||
| witneys | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
| cystein | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cystine | 7 | 12 | nounn | |||||
noun • a crystalline amino acid found in proteins (especially keratin); discovered in bladder stones | ||||||||
| destiny | 7 | 11 | nounn | |||||
noun • an event (or a course of events) that will inevitably happen in the future • the ultimate agency regarded as predetermining the course of events • your overall circumstances or condition in life (including everything that happens to you) | ||||||||
| density | 7 | 11 | nounn | |||||
noun • the amount per unit size • the spatial property of being crowded together | ||||||||
| syenite | 7 | 10 | noun, adjectiven, adj | |||||
noun • Granite. • An igneous rock composed of feldspar and hornblende. | ||||||||
| tensity | 7 | 10 | nounn | |||||
noun • the physical condition of being stretched or strained | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
tinseyWords (38)
silentlyserenitysenilitysteinwaysnippetycytosinetyrosinesynecticyeastingsyndeticsyenitessyeniticcysteineserotinythyminestintypeskyanitescyanitesvenositytinsellymisentryepinastycysteinscystinestensiblyethinylstinselryyawniestwytensindesyatinyeatsianentryismentryistsyntenicpycnites
...View all with 8 letters...
Words (96)
testimonynecessityintensitysinceritysyntheticsyndicateintenselyobscenitysenioritysynthesisintensifyimmensitydentistryhygieniststorylinehypnotisesolemnityhesitancyeyestrainsteadyingteasinglystridencytyrannisejestinglysinuatelyantitypesstymieingnervosityrestylingegyptianssynergistcysteinessalientlytensilitytyrannies
...View all with 9 letters...
Phrases (5)
mike tysonthe skinnyskinny tiesticky endsafety pinWords (171)
universitygenerosityeyewitnessinsecuritytestifyingsensualitystationerymistakenlydishonestystrychninesyndicatedostensiblysynthesizepropensityhypnotisedstringencyisocyanateunpriestlysynthesiseinsolentlymanifestlystridentlyminstrelsycurtseyingunsteadilystupefyingmyastheniahesitantlysinisterlysyncretisesyncretizesynergeticinsistencyinsobrietysynthesist
...View all with 10 letters...
Phrases (10)
unix systemnorse deitywalt disneytin pyritessibley tenttoy spanielwei dynastycystic veinwhisky neatlay witnessWords (250)
personalityessentiallycountrysidesensitivitysovereigntyconsistencyspontaneitysensibilitysynthesizerincessantlyextensivelycrystallineserendipitysedimentaryscientologyintensivelysynesthesiasynthesizedpersnicketyobstinatelydishonestlysensitivelyhypotensivetypesettingcyberneticspointlesslyinsinceritysynergisticstringentlypersistencyantislaverytypecastingtenaciouslyhypotensioninsistently
...View all with 11 letters...
Phrases (25)
laying wastesingle entryclosely knitvena cysticaopen societywhiskey neatgenus myotisstay in placedrain systemloosely knit
...View all with 11 letters...
Words (300)
passionatelysufficientlygynecologistconsistentlystorytellingconstituencybiosynthesishypertensionpresbyterianpersistentlyhypertensivepyrotechnicsstaggeringlystereotypingintensifyingincestuouslyuniversalitysequentiallystreptomycinindiscreetlyhypnotisablemeniscectomysynthesizingnauseatinglysynaesthesiasolzhenitsynhesitatinglyquestionablysempiternitysimultaneityungenerositybiosyntheticsyncretisingblisteringlysyncretizing
...View all with 12 letters...
Phrases (53)
staying powerchinese deityphantasy lifestring theoryrisky venturetennis playernew jerseyitecandy stripergenus trionyxsafety margin
...View all with 12 letters...
Words (301)
instinctivelyinterestinglygynaecologisteverlastinglyconsecutivelydiscretionaryunsympatheticinconsistencyintravenouslydistressinglysensationallyinsensitivitysentimentallyinsensitivelyunobtrusivelyexistentiallydistinctivelysyntheticallyquestioninglyphysostigminehypothesisingpretentiouslyconsideratelygeostationarypsychokineticproselytizingincontestablyhypothesizingunderstudyingclandestinelytonsillectomyinexhaustiblyinstructivelyinquisitivelysubserviently
...View all with 13 letters...
Phrases (81)
auditory sensebrandy snifterspiny anteaterdrimys winteriacrylate resinjapanese deityyes-no questiongenus martyniascoring systemgenus dactylis
...View all with 13 letters...
Words (284)
responsibilitysimultaneouslyscientificallysentimentalityhypersensitiveunquestionablycytogeneticistphotosynthesisthermodynamicsconservativelychemosynthesispsychoneuroticnarcosynthesisdimensionalityinsufficientlyconstructivelypyelonephritisostentatiouslyphotosyntheticunsuspectinglymysteriousnesschemosynthetichydrocortisoneanesthesiologyunhesitatinglydisconsolatelyconsuetudinaryabsentmindedlycytotaxonomiesdiscontentedlynoncrystallineindestructiblypolybutadienescompensabilityunrestrainedly
...View all with 14 letters...
Phrases (109)
field intensitydrainage systemabstract entityoyster dressingparts inventoryturkey stuffingoyster stuffingmargin of safetysubstantive dyecrime syndicate
...View all with 14 letters...
Words (224)
instantaneouslyanaesthesiologyconscientiouslysynergisticallyinaccessibilityinfinitesimallyinstrumentalitycontroversiallycompassionatelyrecrystallizingphotosynthesizeintrospectivelydemonstrativelyunquestioninglydispassionatelyinconsideratelyneuropsychiatrysymmetricalnesssystematizationkinestheticallyinsurrectionaryunsymmetricallyhypersensitizeddemonstrabilitycentrosymmetricsidesplittinglyinteruniversitysemidocumentarycommiseratinglydemystificationmethylxanthinesserendipitouslydisenchantinglydishearteninglyelectroanalysis
...View all with 15 letters...
Phrases (154)
stay of executionalimentary pastewassily leontiefsolemnity of marystonecrop familyrationalise awaygenus cyanocittatietze's syndromemythical monsteramebic dysentery
...View all with 15 letters...
Words (100)
enthusiasticallyindiscriminatelyirresponsibilityquintessentiallyhypersensitivityconversationallyneuropsychiatrichypersalivationsinextinguishablycommensurabilityhypersensitizinginexhaustibilityunostentatiouslyhyperstimulatinghyperstimulationadministrativelyhypervitaminosesindiscernibilitymonotheisticallycrossopterygianscryopreservationindispensabilitylyginopteridalesstenographicallyflabbergastinglystereophonicallyphotosensitivitycyanoethylationskinaestheticallycytotechnologiesinsusceptibilitycytotechnologiststrongyloidiaseslymphangiectasiadecarboxylations
...View all with 16 letters...
Phrases (152)
in a beastly mannerstrictly speakingchristian huygensnevil shute norwaymechanical systemlaundry stiffenerpharyngeal tonsilrelay transmitterzea mays indentatauninominal system
...View all with 16 letters...
Words (69)
counterinsurgencysuperconductivityneurophysiologistinconsequentiallyinterdisciplinaryself-contradictoryisoelectronicallyspondylolisthesishyperstimulationshyperventilationshypnotizabilitiesthrombocytopeniasmonosyllabicitiespaternalisticallyhyposensitizationunderstandabilitycryopreservationscryptocrystallineencephalomyelitispostrevolutionarylymphadenopathiesuncontroversiallyrecrystallizationcytotechnologistsstrongyloidosisesphenylethylaminestridimensionalityindestructibilitytriiodothyroninestriphenylmethanesjurisprudentiallydisadvantageouslyneuropsychiatriesneuropsychiatristneuropsychologist
...View all with 17 letters...
Phrases (170)
balaena mysticetusinterstate highwaypearly everlastingcylinder separatorinvestment companyanemone sylvestrisuniversity of parissubfamily lutrinaepython reticulatusdisorderly conduct
...View all with 17 letters...
Words (45)
disproportionatelyinconsequentialityhyperaldosteronismhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationsphygmomanometrieshypophysectomizinghyposensitizationscylindrical-stemmedtriphosphopyridinerecrystallizationsmagnetostrictivelydehydrochlorinatestrichloroethylenesgranulocytopoiesesgranulocytopoiesisaerothermodynamicsneurophysiologistsrepresentationallyneuropsychiatristsneuropsychologistsdemythologizationsmethylprednisoloneincommensurabilitydephosphorylationschlortetracyclinessedimentologicallyphotosyntheticallycytoarchitectonicssemiconservativelyhydroxytryptamineshyperalimentationssemiquantitatively
...View all with 18 letters...
Phrases (172)
administrative bodydame sybil thorndikelachrymal secretionnavigational systemcolumbia universityantipsychotic agentgenus chamaecytisustendonous synovitissolid body substanceambystoma mexicanum
...View all with 18 letters...
Words (30)
polyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesnonrelativisticallyconceptualisticallycytopathogenicitiesimmunocytochemistryphenomenalisticallyphosphatidylcholinecontradistinctivelythird-dimensionalityhysterosalpingogramthree-dimensionalityimpressionisticallymethylprednisolonesincomprehensibilityencephalomyelitidesdihydrostreptomycindiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexhibitionisticallyexpressionisticallymultidimensionalityPhrases (180)
john millington syngehydrastis canadensisgiles lytton stracheyzairese monetary unitchinese monetary unitsalicylate poisoninguniversity of chicagodasypus novemcinctussymphytum officinalecost-benefit analysis
...View all with 19 letters...
Words (20)
uncharacteristicallyoverenthusiasticallyhypersensitivenesseshyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallymagnetohydrodynamicsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditissyncategorematicallydimethylnitrosaminesexistentialisticallyPhrases (149)
william stanley jevonslebanese monetary unitdivision tracheophytabalance sheet analysisuniversity of nebraskamilton snavely hersheyambystomid salamanderclassification systemclassifying adjectivefriendly relationship
...View all with 20 letters...
Words (5)
immunocytochemistriesacetylcholinesterasesotorhinolaryngologiesintersubstitutabilitytetrahydrocannabinolsPhrases (117)
electrolytic condenseraleksandr solzhenitsynmalaysian monetary unitsri lankan monetary unitpseudemys rubriventriseucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaparty to the transactionstrawberry haemangioma
...View all with 21 letters...
Words (2)
intercomprehensibilityencephalomyocarditisesPhrases (132)
lycopersicon esculentumaleksandr i. solzhenitsynloyalist volunteer forcehigh-density lipoproteinrhythm and blues musiciancrescent city connectionsurinamese monetary unitfamily branchiostomidaejohns hopkins universityindonesian monetary unit
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (94)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universitykyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitor
...View all with 23 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (66)
carnegie mellon universitysubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinsir terence mervyn rattigandistinguished flying crossexistentialist philosophytechnology administrationhypersensitivity reactionanal retentive personality
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (70)
francis scott key fitzgeraldedmund john millington syngereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline systemsir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovskywestern samoan monetary unitsuborder petromyzoniformes
...View all with 25 letters...
Phrases (46)
hunting and gathering societysecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsubdivision deuteromycotinasystem of weights and measuresbenign prostatic hyperplasia
...View all with 26 letters...
Phrases (45)
business environment analysisnikita sergeyevich khrushchevaugustus welby northmore pugincommissioned military officernuclear regulatory commissiondeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatejames augustine aloysius joycethyrotropin-releasing hormone
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (36)
revolutionary people's struggletriphosphopyridine nucleotidemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguecount lev nikolayevitch tolstoy
...View all with 28 letters...
Phrases (22)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndrome
...View all with 30 letters...
Phrases (12)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositiondefense information systems agency
...View all with 31 letters...
Phrases (17)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory druguniversity of california at berkeleytheory of electrolytic dissociationlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (13)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (10)
university of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicine
