8-Letter Words Containing: E,I,N,S,T,Y
(In Any Order)
There are 38 8 letter words,
0 8 letter phrases and
0 8 letter abbr's with
E,I,N,S,T,Y in.
Best Scoring 8 Letter Words With: E,I,N,S,T,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| thymines | 8 | 16 | ||||||
noun • a base found in DNA (but not in RNA) and derived from pyrimidine; pairs with adenine | ||||||||
| snippety | 8 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| synectic | 8 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kyanites | 8 | 15 | nounn | |||||
noun • a grey or greenish-blue mineral consisting of aluminum silicate in crystalline form; occurs in metaphoric rock, used as a refractory | ||||||||
| syndetic | 8 | 14 | adjectiveadj | |||||
adjective • connected by a conjunction | ||||||||
| venosity | 8 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| ethinyls | 8 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cytosine | 8 | 13 | nounn | |||||
noun • a base found in DNA and RNA and derived from pyrimidine; pairs with guanine | ||||||||
| syenitic | 8 | 13 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| cysteine | 8 | 13 | nounn | |||||
noun • an amino acid containing sulfur that is found in most proteins; oxidizes on exposure to air to form cystine | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 8 Letter Words
Words (38)
silentlyserenitysenilitysteinwaysnippetycytosinetyrosinesynecticyeastingsyndeticsyenitessyeniticcysteineserotinythyminestintypeskyanitescyanitesvenositytinsellymisentryepinastycysteinscystinestensiblyethinylstinselryyawniestwytensindesyatinyeatsianentryismentryistsyntenicpycnitescytisinesyntexissixty-one
