Words Containing: E,I,G,Y
(In Any Order)
There are 3,090 words,
2,237 phrases and
0 abbr's with
E,I,G,Y in.
Best Scoring Words With: E,I,G,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
weighty | 7 | 17 | adjectiveadj | |||||
adjective • having relatively great weight; heavy adjective satellite • powerfully persuasive • of great gravity or crucial import; requiring serious thought • weighing heavily on the spirit; causing anxiety or worry • excessively fat | ||||||||
effigy | 6 | 16 | nounn | |||||
noun • a representation of a person (especially in the form of sculpture) | ||||||||
epigyny | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
fidgety | 7 | 15 | adjectiveadj | |||||
adjective satellite • nervous and unable to relax | ||||||||
pygmies | 7 | 15 | noun, adjectiven, adj | |||||
noun • any member of various peoples having an average height of less than five feet • an unusually small individual | ||||||||
gynecic | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
defying | 7 | 15 | adjectiveadj | |||||
verb • resist or confront with resistance • elude, especially in a baffling way • challenge | ||||||||
yerking | 7 | 15 | verbv | |||||
verb • To stab. • To throw or thrust with a sudden, smart movement; to kick or strike suddenly; to jerk. • To strike or lash with a whip or stick. • To rouse or excite. • To bind or tie with a jerk. | ||||||||
wiggery | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
gemmily | 7 | 15 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (87)
yellingdenyinghygienesyringerelyingimageryyelpingweightyenvyingfidgetylevyingbelyingglycinepiggeryretyinggreyishlegiblyagilelygreyingyeaningpreyinggypsiedgelidlyyenningpygmiesisogenydingeyseddyingyealinggyneciagynecicbigeyesobeyinggingerybiggety
...View all with 7 letters...
Phrases (5)
guy wirekey ringwise guyglide bygive wayWords (179)
egyptianideologyeyesightyearningregistryhygienicemptyingsyringesgiveawayyodelingyieldinglegalityrelayingedifyingbelayingreadyinggingerlyglyceringreedilylayeringglitterybenignlybellyingridgewayvinegaryferryinggentrifymoseyinggigabyteglimmeryretryingetiologywearyingyearlingexigency
...View all with 8 letters...
Phrases (7)
egg yieldbig moneygive awayby designgregory imagic eyesego lilyWords (298)
integrityillegallygenuinelyseeminglyrecyclinghemingwayingenuitylongevityverifyingcryogeniceasygoingsurveyinghygienistglycerineprettyingconveyinggentilitymonkeyingglycosidejockeyingparleyingdysgenicsreburyingsteadyingyodellingfeelinglyembodyingpanegyricpolygenicremedyingforeignlysyllogizepyrogenicmuybridgegeniality
...View all with 9 letters...
Phrases (16)
high stylegrey friargin rickeyegg layingivy leagueeasy goinggrey birchtiger lilyyogi berragerman ivy
...View all with 9 letters...
Words (409)
everythingterrifyinggenerositytestifyingunderlyingnegativitynegativelydiligentlyinsurgencylegitimacyneighborlygrievouslyunyieldingregularityoverpayingunhygienicillegalitycertifyingexobiologyspecifyingmenacinglyhieroglyphjourneyingseismologyremarryingstringencyrectifyingoverlayingcryogenicspleasinglyreapplyingladyfingerexactinglyoxygenizedfetchingly
...View all with 10 letters...
Phrases (44)
body weightenergy unitgrey willowwedding daytight moneygreek deityivy leaguerleydig cellglycine maxeating away
...View all with 10 letters...
Words (478)
geneticallyheavyweightdaydreamingsovereigntyidentifyingcontingencyexceedinglyterminologyreligiouslyeligibilitylingonberryscientologyinteragencycopyrightedtypewritingangelicallydehydratingcarriagewaygeophysicallingeringlypennyweightdeservinglyneighbourlytypesettingunceasinglyirregularlycognitivelykinesiologyegregiouslyoxygenationrighteouslysickeninglydisgustedlymoneymakingsynergistic
...View all with 11 letters...
Phrases (82)
genus myxinelaying wastemighty mousebulb syringesingle entryplaying areadry cleaningturdus greyiafrican greymemory image
...View all with 11 letters...
Words (486)
increasinglygynecologistaggressivelystorytellingfigurativelytriglyceridedelightfullylegitimatelyelectrifyinghieroglyphicrefreshinglytrigonometryegyptologistcongenialityecologicallyterrifyinglycompellinglybelligerencyphylogeneticbegrudginglyhypoglycemicstaggeringlyirregularitystereotypingintensifyingenchantinglyepidemiologymagneticallygeologicallysuperhighwaydepressinglydespairinglyresoundinglygeophysicisthygienically
...View all with 12 letters...
Phrases (123)
woody guthriestaying powergenus glycinegenus syringainquiry agentstring theorybaby carriagegenus cydoniapolicy changeacid hydrogen
...View all with 12 letters...
Words (403)
interestinglyprogressivelyhieroglyphicsgynaecologiststrategicallycategoricallyintelligentlyfrighteninglymagnificentlynitroglycerineverlastinglyideologicallyoveranalyzingbiotechnologyhypoglycaemicdistressinglyenergeticallygynecologicalunremittinglydeoxygenationhyperglycemicendocrinologyunrelentinglymeaninglesslydisgracefullygeometricallyquestioninglyphysostigminehypothesisingtheologicallymagisteriallyhydrogenationoverbearinglygeostationaryinterrogatory
...View all with 13 letters...
Phrases (168)
harvey cushingvaginal arterygilbert murrayproperty rightradiant energygenus acinonyxgenus cyprinusgenus martyniascoring systemgenus erysimum
...View all with 13 letters...
Words (290)
cinematographyoverwhelminglygeographicallycytogeneticistnitroglycerineexcruciatinglygynaecologicalembarrassinglyunintelligiblyentertaininglydemythologisedunsuspectinglyanesthesiologysuggestibilityetymologicallyunhesitatinglyethnologicallyoverpoweringlymagniloquentlyillegitimatelyimpregnabilitydemythologizeddisingenuouslythymectomizingdepolymerizinggenerationallylightheartedlygeohydrologistheterozygosityhypoallergenicupgradeabilitygenealogicallymyrmecologistsegocentricallyhyperpigmented
...View all with 14 letters...
Phrases (184)
high technologyveliky novgorodgenus gossypiumgenus syngoniumdrainage systemdizzy gillespieoyster dressingturkey stuffingoyster stuffingright to liberty
...View all with 14 letters...
Words (217)
technologicallyanaesthesiologysynergisticallyoversimplifyingcondescendinglyneurophysiologycytomegalovirusrecrystallizingunquestioninglyseismologicallycorrespondinglydemographicallyheartbreakinglyinterrogativelyunchangeabilitysidesplittinglyhyperimmunizingcommiseratinglymarriageabilityunintelligentlydisenchantinglyretrogressivelynonbelligerencydishearteninglyphytopathogenichyperaggressiveintelligibilitydaguerreotypistuncopyrightableoverclassifyingnitroglycerineshypervigilanceshyposensitizinggravimetricallyresystematizing
...View all with 15 letters...
Phrases (220)
benefit of clergyasamiya languagemail-order buyingsystem of weightsgenus sylvilagusgenus bombycillahyoscyamus nigerfamily triglidaegenus cyanocittaarachis hypogaea
...View all with 15 letters...
Words (83)
hyperintelligentphylogeneticallyunapologeticallyinextinguishablyparamagneticallytrinitroglycerinhypersensitizingmicrogametophytehyperstimulatingparapsychologiesdimethylglyoximehyperventilatingarchaeologicallyhemoglobinopathycrossopterygianslyginopteridalesstenographicallyhypopigmentationflabbergastinglyflexographicallyflibbertigibbetystereoregularityindefatigabilitycytotechnologiescytotechnologistdaguerreotypistsstrongyloidiaseslymphangiectasialymphangiectasispetrographicallyconsanguineouslyoligodendrocytesimmunohematologyecophysiologicalgeneralizability
...View all with 16 letters...
Phrases (202)
italian greyhoundstrictly speakingchristian huygenscardiac glycosidecommercial agencyautogenic therapycalystegia sepiumisland of guernseypharyngeal tonsilcynoscion regalis
...View all with 16 letters...
Words (57)
counterinsurgencybacteriologicallyneurophysiologistunexchangeabilitypathophysiologiesferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologycytomegalovirusescytopathogenicitycytotechnologistsimmunogeneticallyelectronegativitystrongyloidosisesoceanographicallyzoogeographicallysamoyedic-speakingtrigonometricallyhyperintelligenceunintelligibilityneurophysiologiesdisadvantageouslyelectromyographicneuropsychologiesneuropsychologistmetapsychologicalsuperheavyweightselectrophysiologyhyperpigmentationdephosphorylatingpalaeoclimatologyhistophysiologiesuncomprehendingly
...View all with 17 letters...
Phrases (195)
hypoglycemic agentinterstate highwaypearly everlastingmalaysian languagetheological systemrepublic of hungaryyeniseian languagefamily engraulidaeindependent agencygenus dactylorhiza
...View all with 17 letters...
Words (32)
hypercoagulabilityinterchangeabilityneuropsychologicalspectroheliographysphygmomanometrieshypophysectomizinglymphangiographiesmagnetostrictivelyphenomenologicallygeochronologicallyneuroendocrinologygranulocytopoiesesspectrographicallygranulocytopoiesisneurophysiologistselectromyographiesultracentrifugallyneuropsychologistsmetallographicallydemythologizationselectrophysiologicroentgenologicallyhydrometallurgicalsedimentologicallyhydrometallurgistshydrometeorologieshydrometeorologistphytohemagglutinindihydroergotaminespsychophysiologiesneurophysiologicalhyperpigmentationsPhrases (215)
revolutionary groupfreudian psychologyafghan monetary unitnavigational systemfamily asparagaceaeantipsychotic agentfamily polygalaceaegenus chamaecytisusfulminating mercuryfamily magnoliaceae
...View all with 18 letters...
Words (18)
cinematographicallyextralinguisticallyparthenogeneticallycytopathogenicitiesmagnetohydrodynamicdehydrochlorinatingelectromagneticallyhysterosalpingogramelectrophysiologieselectrophysiologistelectroretinographycharacterologicallyhydrometeorologicalhydrometeorologistsphytogeographicallyphytohemagglutininspaleogeographicallyelectrocardiographyPhrases (161)
building supply housejohn millington syngefamily cynoglossidaealpine type of glaciergiles lytton stracheygenus symphoricarposavogadro's hypothesissalicylate poisoninghydrobates pelagicusuniversity of chicago
...View all with 19 letters...
Words (12)
polyphiloprogenitivemagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsroentgenographicallypsychopharmacologiessyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (121)
clyde william tombaughbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosfamily gasterosteidaeunabridged dictionarymilitary intelligenceglycerol tripalmitateegyptian monetary unit
...View all with 20 letters...
Words (5)
hypogammaglobulinemiaotorhinolaryngologieselectromyographicallydendrochronologicallyantiferromagneticallyPhrases (101)
bulgarian monetary unithungarian monetary unitextrauterine pregnancycynoglossum officinalenorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaardsamuel taylor coleridgeagricultural chemistry
...View all with 21 letters...
Words (1)
electrophysiologicallyPhrases (88)
high-density lipoproteinguatemalan monetary unitnicaraguan monetary unitparaguayan monetary unitguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellington
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (54)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationfederal republic of germanyandrei andreyevich gromyko
...View all with 24 letters...
Phrases (27)
diamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngereligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigades
...View all with 25 letters...
Phrases (27)
brassica oleracea gongylodeshunting and gathering societyevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndrome
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (29)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (13)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planninghuygens' principle of superposition
...View all with 31 letters...
Phrases (12)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusnonsteroidal anti-inflammatory drugprimary subtractive colour for lightlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay