Words Containing: E,E,Y,A,H
(In Any Order)
There are 1,233 words,
1,796 phrases and
0 abbr's with
E,E,Y,A,H in.
Best Scoring Words With: E,E,Y,A,H
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| eyewash | 7 | 16 | nounn | |||||
noun • lotion consisting of a solution used as a cleanser for the eyes | ||||||||
| hayseed | 7 | 14 | noun, adjectiven, adj | |||||
noun • a person who is not very intelligent or interested in culture | ||||||||
| eyelash | 7 | 13 | nounn | |||||
noun • any of the short curved hairs that grow from the edges of the eyelids | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (55)
treacherytelepathyarchetypeemphysemaarchenemyweatherlybellyachedehydratehyphenateanywhereshackneyedalleghenyabernethyhyperemiaeyeshadowaerophytehaecceityhymenealshemelytrawheyfacedrehydrateerythemaseyeshadesteacherlyheadacheyrakehellyethylatedethylatesmethylasemethylatewheyfacesmelaphyrealdehydeshyperpneapachytene
...View all with 9 letters...
Phrases (8)
alex haleyspeech daypaul heyseelihu yalehoney bearhoney cakehead rhymegrey whaleWords (97)
hereditaryhyperspacedehydratedsleepyheaddebaucheryhyphenatedlymphedemachalybeateepiphysealtelegraphymethylatedbellyacherphlyctenaehoneyeateradherentlydehydrateshepatocyterehydratedrehydratesaerophyteseuryhalinebellyachedsuperheavyhyphenatessynthetaseaerenchymaheterogamyadhesivelymethylasesmethylateshymeneallydetachedlymelaphyreshyperplanehyperpneas
...View all with 10 letters...
Phrases (25)
honey eaterwheat berryheavy swellhook and eyehenry jameshappy eventhelen hayesweather eyehockey gamehockey team
...View all with 10 letters...
Words (134)
heavyweighthypermarketshamelesslyhyperactivehorseplayerbathyspheresynesthesiachancelleryschenectadythermopylaepsychedeliamethylamineheartlesslyhymenopterahepatectomyparaldehydebreathalysehoneyeatersdeathlesslypolychaetespigheadedlyhydrogenateshapelesslyephemerallyetherealitysleepyheadsbellyachersheartsomelycyclohexaneaerenchymashypermediashotheadedlyhepatocytesenteropathyhypermnesia
...View all with 11 letters...
Phrases (32)
mary shelleyhoney badgermemory cacheheavy hitterchess playergenus hyaenaevelyn waughwhiskey neattake-home payhockey skate
...View all with 11 letters...
Words (191)
chemotherapyformaldehydeperipherallybreathlesslyphenomenallybreathalyzerhermeticallypolyurethanehyperthermiaarcheopteryxhyperkalemiaerythematousmealymouthedhaberdasheryhydrogenatedexhaustivelybreathalyserdysmenorrheamethacrylatesynaesthesiaestheticallyephemeralitystonyheartedtracheophytehepatomegalyevenhandedlyhypothecatedhyperkinesiaheterokaryonmethylaminesunhyphenatedshamefacedlyhemihydrateshypermutableheavyhearted
...View all with 12 letters...
Phrases (53)
hockey leagueathletic typebarbary sheepedmond halleyedmund halleythree-year-oldhawkeye stateandrew huxleyday of the weekdame myra hess
...View all with 12 letters...
Words (167)
theoreticallyaestheticallydehydrogenasearchaeopteryxhypercalcemiatreacherouslyacetylcholinesoutheasterlyunderhandedlynortheasterlythreateninglyhalfheartedlyoystercatcherhypermetropiaspermatophytesoftheartedlyhyperinflateddownheartedlyhymenopteranshyperacuitiesclearheadedlyopenheartedlycoldheartedlytetrahedrallyhyperkinesiasbutyraldehydeheterokaryonshyperlipemiasparasyntheseshypermetricalphanerophytesdysmenorrheasdermatophyteshyperparasitehyperglycemia
...View all with 13 letters...
Phrases (76)
hydrated oxideorder of the dayjekyll and hydeheavy hydrogenshammy leatherheavy particlegenus nymphaeathree kings' dayqueen of the mayhouse of prayer
...View all with 13 letters...
Words (179)
wholeheartedlyelectrotherapyhyperventilatetelepathicallyencephalopathytelephonicallyanesthesiologyempatheticallycyproheptadineheavyheartedlyhyperkeratoticlightheartedlyhypermasculinedehydrogenasesgreatheartedlyhypermetropiashypoallergenicmethylxanthineweatherabilityoystercatcherspyrimethamineshyperrealistichyperawarenesspseudepigraphydiphenylaminesexothermicallyspermatophyteshypervigilancehyperesthesiasstoutheartedlypaleogeographydimenhydrinatefaintheartedlyhyperirritablehyperkeratoses
...View all with 14 letters...
Phrases (80)
primary featherchinese parsleyoriental cherryjapanese cherryhenry cavendisherythema solareartillery shellfly in the face oftheater companygenus sphyraena
...View all with 14 letters...
Words (139)
anaesthesiologyheterosexualityparentheticallytherapeuticallymethylphenidateencephalographyheartbreakinglyeuphemisticallydiphenhydraminekinestheticallymegagametophytepsychedelicallytenderheartedlymethylxanthinesdishearteninglyhyperaggressivecyproheptadineshyperstimulatedhyperstimulatessaccharomyceteshypercoagulablehypervigilancescyclohexylaminetelegraphicallytetramethylleadroentgenographyhermeneuticallyhyperlipidemiaselectromyographoxyphenbutazonehypermetabolismmethoxyfluranesdehydrogenatingdehydrogenationphototelegraphy
...View all with 15 letters...
Phrases (138)
spiny-headed wormlymphatic vesselchicory escarolejohnny appleseeddehydrated foodsthree-day measlesgenus menyanthesrichard henry leepygmy chimpanzeebirthday present
...View all with 15 letters...
Words (74)
triphenylmethanehyperventilationphylogeneticallyelectromyographysphygmomanometerheterokontophytahymenophyllaceaeparaformaldehydethermometricallymicrogametophytehypersexualitiesthermoregulatoryapocryphalnesseshyperventilatinghypervitaminosesstereophonicallycyclohexylamineshydrocharidaceaekinaestheticallyhydrocharitaceaehypercellularityphenylethylamineleptotyphlopidaephenylketonuriasneurasthenicallyheavyheartednessorthogeneticallyadenohypophysealdehydrogenationsmechanochemistryneurohypophysealelectrohydraulicmegagametophytesphosphoglyceratehysterocatalepsy
...View all with 16 letters...
Phrases (142)
william wycherleyhome away from homebattle of the boynenevil shute norwayautogenic therapymechanical systemyeoman of the guardmythical creaturerheims-douay biblefamily rhamnaceae
...View all with 16 letters...
Words (50)
psychotherapeutichyperreactivitiesphysiotherapeuticcercidiphyllaceaeunexchangeabilityparaformaldehydeshyperventilationssphygmomanometerschlortetracyclinemorphogeneticallyencephalomyelitislymphadenopathieshyperalimentationthiodiphenylaminephenylethylaminesstereophotographynephelometricallyelectrochemicallydehydrochlorinasedehydrochlorinatetriphenylmethanesaerothermodynamicphosphoglyceratesneuropsychiatrieselectromyographicmesembryanthemumssuperheavyweightsmethylnaphthalenebacillariophyceaehyperpigmentationheterotrophicallypalaeoethnographypseudoparenchymashydroelectricallyhydrometallurgies
...View all with 17 letters...
Phrases (169)
czech monetary unitmary mcleod bethunehypoglycemic agentinterstate highwayclass rhodophyceaetheological systemfamily didelphidaepetasites hybridushereditary patterngenus haematoxylon
...View all with 17 letters...
Words (37)
hyperaldosteronisminterchangeabilityhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshyperbilirubinemiapteridospermaphytadiethylmalonylureahypercholesteremiasaccharomycetaceaephenomenologicallyhydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesaerothermodynamicselectromyographieselectrooculographymethylcholanthreneheavyheartednessesmethylnaphthaleneselectrophotographyhomobasidiomycetespseudoparenchymatachlortetracyclinestetrachlorethylenechlamydomonadaceaediethylcarbamazinehyperalimentationstetraiodothyroninehyperconcentrationdihydroergotaminesdimethylhydrazinesdimethyltryptamine
...View all with 18 letters...
Phrases (163)
family physeteridaedame sybil thorndikelachrymal secretionjohn orley allen tateclass schizomycetesread-only memory chipfamily trichechidaegenus chamaecytisusfamily loranthaceaearchitectural style
...View all with 18 letters...
Words (30)
hypersensitizationsparathyroidectomieshypolipoproteinemiaparthenogeneticallycytopathogenicitiesphenomenalisticallyphenylthiocarbamideechoencephalographyphosphoenolpyruvateelectromechanicallythree-dimensionalityelectrophoreticallymethylcholanthreneselectroretinographyencephalomyelitidesphenylpropanolaminehydroxytetracyclinetetrachloroethylenehydrometeorologicaltetrafluoroethylenediethylcarbamazineshyperconcentrationstetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiespaleogeographicallyelectrocardiographyPhrases (150)
giles lytton stracheychinese monetary unithydrobates pelagicussubfamily mephitinaetheory of inheritancejapanese honeysucklesecondary censorshipfamily euphorbiaceaecapital of seychellesgerard manley hopkins
...View all with 19 letters...
Words (17)
hypercholesterolemiaoverenthusiasticallyparathyroidectomizedhyperadrenocorticismphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiaelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoushypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesPhrases (159)
yellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaebalance sheet analysisfamily dermochelyidaebenjamin henry latrobemilton snavely hersheyfriendly relationship
...View all with 20 letters...
Words (6)
acetylcholinesterasesphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydehypercholesterolemiaspsychotherapeuticallyPhrases (122)
aleksandr solzhenitsynhelichrysum bracteatumbyzantine architecturestrawberry haemangiomafamily rhinotermitidaeptolemy ii philadelphusprocaine hydrochloridefamily myrmecophagidaehans holbein the youngerphylum platyhelminthes
...View all with 21 letters...
Words (9)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (99)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factmultiple mononeuropathyathyrium thelypteroidesbrachycome iberidifoliaatmospheric electricity
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (70)
family threskiornithidaebangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy missionchrysanthemum partheniumdepartment of the treasuryartocarpus heterophyllus
...View all with 23 letters...
Words (5)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (60)
argyroxiphium sandwicensedivision heterokontophytaprivately held corporationprimary sex characteristicexistentialist philosophyhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanumhaematoxylum campechianum
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (54)
mary wollstonecraft shelleymelanerpes erythrocephalusbeggar-my-neighbour strategypyotr alexeyevich kropotkinsir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromehormone-replacement therapyembryonic stem-cell researchreticuloendothelial system
...View all with 25 letters...
Phrases (42)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (27)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (26)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl celluloseaspidophoroides monopterygius
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationsecondary sexual characteristicbreach of the covenant of warranty
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornmucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trends
...View all with 30 letters...
Phrases (12)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (8)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn
