Words Containing: E,E,R,I,T,Y
(In Any Order)
There are 1,626 words,
2,293 phrases and
0 abbr's with
E,E,R,I,T,Y in.
Best Scoring Words With: E,E,R,I,T,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
yperite | 7 | 12 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (43)
celebritymysteriesdexterityextremityelectrifyeyestraintypewritepriestleyeruditelydecertifyinebrietyrenitencyreticencyrestivelyrecertifyerythemicperistylefertilelyretestifysterilelyperimetrygeyseriteseriatelyeyebrighterythritelysimetertriweeklyretiredlytigereyesdesertifyjequeritygrey-whitepyreneiteright-eyedperennity
...View all with 9 letters...
Phrases (5)
direct dyeriver tynetyne riverivory treetrygve lieWords (93)
everythingrelativelygenerositytypewriterhereditarydiscreetlyveterinaryinherentlycreativelytirelesslyperpetuitydiscretelycyberneticperversitytiresomelypernicketyinexpertlyperplexitygeneralityliteratelysyncretisesyncretizesynergeticbewitcherypertinencyesurientlyeruptivelyexteriorlysymmetrizepyroxenitedysentericinterlayerinveteracysymmetriesdecrepitly
...View all with 10 letters...
Phrases (16)
private eyeenergy unitgreek deityeaster lilynorse deitytime of yearfamily treeepic poetryevery nightjersey city
...View all with 10 letters...
Words (159)
electricitydifferentlysovereigntysynthesizerhyperactiveserendipityevidentiarysedimentaryinteragencypersnicketycyberneticsimperfectlytypewrittenwinterberrypersistencyreflexivityreceptivityproselytizesecretivelyyesternightsynthesiseroperativelybicentenarystereotypicproselytiseperceptiblybenedictorysyncretisedsyncretisessyncretizesreceptivelyiterativelysymmetrizedassertivelyrehypnotize
...View all with 11 letters...
Phrases (26)
single entryheavy hitteremily brontecelery sticketernal citytissue layerelectric rayfield theorypoverty linevariety meat
...View all with 11 letters...
Words (248)
deliberatelypenitentiaryintermediarytriglyceridehypertensionrespectivelyelectrifyingpresbyterianincoherentlyelectricallypersistentlyhypertensiveeccentricityelectrolysispejorativelyhermeticallyinfrequentlystereotypinghyperthermiarespirometryreflectivelytetracyclineindiscreetlyhyperkineticimmoderatelyrehypnotizeddeterminablyperceptivelyinadvertencyfreneticallypermeabilityperemptorilyrepetitivelyirrelevantlydeterminedly
...View all with 12 letters...
Phrases (43)
lienal arteryrisky venturetennis playernew jerseyitein perpetuitypetit larcenyfifty percentheroic poetrydivinyl ethertraverse city
...View all with 12 letters...
Words (265)
theoreticallyinterestinglyinadvertentlyirretrievablyalternativelyeverlastinglystereotypicalexpeditionaryimperceptiblyconfectioneryindifferentlyenergeticallyhydroelectricpredominatelyeccentricallypicturesquelyunrelentinglyretroactivelygeometricallysuperlativelyperspectivelyimpertinentlyindeterminacypretentiouslyreverentiallyhypertrophiedhypervelocityconsideratelydeferentiallyprecipitatelythreateninglybelligerentlypenetratinglyambidexterityquincentenary
...View all with 13 letters...
Phrases (81)
auditory senseinventory itemhydrated oxidespiny anteaterprivate treatyacrylate resinradiant energymemory pictureheavy particlethree kings' day
...View all with 13 letters...
Words (282)
electronicallyrespectabilityhypersensitiveinterplanetaryhyperventilatenitroglycerineintermittentlyconservativelyexperimentallyreproductivelyappreciativelyintermediatelyentertaininglydifferentiallypyelonephritisinterferometrymysteriousnesspreferentiallybioelectricityextortionatelyimpermeabilityserviceabilitycyproheptadinedeliberativelydenumerabilityhyperkeratoticgenerationallylightheartedlyheterozygosityhypermetropiasextemporaneityunrestrainedlyegocentricallyweatherabilityhyperpigmented
...View all with 14 letters...
Phrases (91)
primary featherdrainage systemoriental cherryact reflexivelyoyster dressingcrime syndicateartillery shellliterary periodliterary reviewletter security
...View all with 14 letters...
Words (208)
environmentallydisrespectfullyheterosexualityparentheticallyplenipotentiarymaneuverabilitytherapeuticallystereochemistrypostoperativelyintrospectivelyuninterruptedlydemonstrativelyretrospectivelyheartbreakinglyinconsideratelyinterdependencyinterrogativelysymmetricalnessoxytetracyclinehypersensitizedcentrosymmetricinteruniversitysemidocumentarythyroidectomiesteletypewriterscomplementarityserendipitouslyretrogressivelydishearteninglyelectroanalysisperipateticallycyproheptadineshyperstimulatedhyperstimulatesdaguerreotypist
...View all with 15 letters...
Phrases (147)
benefit of clergyalimentary pasteprivate propertytietze's syndromeamebic dysenterydrive line systemgenus eriobotryaequinoctial yearmagnetic pyritesmanual dexterity
...View all with 15 letters...
Words (106)
hemorrhoidectomytriphenylmethanehyperintelligenthyperventilationimperceptibilityelectrochemistryhypersensitivitypolydispersitiesexterritorialitythermometricallyhypersensitizingmicrogametophytehypersexualitiesimperfectibilityhypersusceptiblehyperventilatinghyperviscositieshypervitaminosesthyroidectomizedleukodystrophiesperpendicularitycryopreservationferroelectricitylyginopteridalesstereophonicallyflibbertigibbetystereoregularitystereoscopicallycytophotometriespiezoelectricityhydrocharitaceaedaguerreotypistsunrespectabilityhypercellularityoligodendrocytes
...View all with 16 letters...
Phrases (200)
tympanic membranein a beastly mannerin an elaborate wayefficiency expertrelative majoritynevil shute norwaycommercial treatyautogenic therapylaundry stiffenerfamily elateridae
...View all with 16 letters...
Words (65)
counterinsurgencyelectrostaticallypsychotherapeutichyperreactivitiesisoelectronicallyphysiotherapeuticthermoperiodicityhyperventilationschlortetracyclineferrimagneticallymorphogeneticallycryopreservationsdisrespectabilityhyperalimentationcytomegalovirusesstereospecificitytrichloroethyleneelectronegativityelectroanalyticalnephelometricallyelectrochemicallydehydrochlorinatetriphenylmethaneshyperintelligenceaerothermodynamicneuropsychiatrieselectromyographicsuperheavyweightscomprehensibilitycarboxypeptidaseselectrophysiologypetromyzoniformeshyperpigmentationretroperitoneallyheterotrophically
...View all with 17 letters...
Phrases (190)
mary leontyne priceczech monetary unitproteolytic enzymeinterstate highwaypearly everlastingotto fritz meyerhofcylinder separatorpetasites hybridusanemone sylvestrishereditary pattern
...View all with 17 letters...
Words (46)
hyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidepsychotherapeuticssphygmomanometriescylindrical-stemmedstereospecificallypteridospermaphytadiethylmalonylureadiethylstilbestrolcounterintuitivelyhypercholesteremiamagnetostrictivelymyeloproliferativehydroflumethiazidedehydrochlorinateddehydrochlorinatestrichloroethylenesgranulocytopoiesespolypropenonitrileaerothermodynamicsrepresentationallyelectromyographieselectrophysiologicmethylprednisoloneroentgenologicallychlortetracyclineshydroelectricitieshydrometeorologieshydrometeorologist
...View all with 18 letters...
Phrases (239)
family physeteridaedame sybil thorndikelachrymal secretionfamily trichechidaesuperiority complexsquirreltail barleyfulminate of mercuryfamily loranthaceaeyemeni monetary unitarchitectural style
...View all with 18 letters...
Words (42)
polyesterificationshypersensitizationspolyribonucleotidesextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallycytodifferentiationdiethylstilbesteroldiethylstilboestrolphenylthiocarbamidemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalityelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyhydroxytetracyclinehydrometeorologicalhydrometeorologistsoverproportionatelydiethylcarbamazinesdiethylstilbestrolshyperconcentrationstetramethyldiarsine
...View all with 19 letters...
Phrases (212)
family cyclopteridaemillimeter of mercuryalpine type of glaciergiles lytton stracheyzairese monetary unitnancy freeman mitfordfamily tropaeolaceaechinese monetary unithydrobates pelagicustheory of inheritance
...View all with 19 letters...
Words (22)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyhypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismcytodifferentiationsphenylthiocarbamidesacetylcholinesterasehyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesroentgenographicallyencephalomyocarditischemotherapeuticallysyncategorematicallyhypercholesterolemichypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesPhrases (201)
yellow-shafted flickerorder mycelia sterilialebanese monetary unitorder myxobacterialesfamily trachipteridaebenjamin henry latrobeuniversity of nebraskamilton snavely hersheymagnetic bubble memoryfriendly relationship
...View all with 20 letters...
Words (8)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesacetylcholinesteraseselectromyographicallyantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (152)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynhelichrysum bracteatumextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesnorwegian monetary unitstrawberry haemangioma
...View all with 21 letters...
Words (6)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesmicrospectrophotometryPhrases (156)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (93)
family threskiornithidaeyellowstone national parkparis-sorbonne universitybangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorgroup pteridospermaphytatricyclic antidepressantmcguffey eclectic readerssearch and destroy mission
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (72)
carnegie mellon universitylouis seymour bazett leakeysubdivision deuteromycotadivision heterokontophytaprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisfluoxetine hydrocholoridehypersensitivity reaction
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (75)
francis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyreligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (53)
hunting and gathering societysecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitationsubdivision deuteromycotinabureau of diplomatic securitysystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (43)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (39)
revolutionary people's struggletriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist league
...View all with 28 letters...
Phrases (26)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensis
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (15)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencyfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (15)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (13)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuseinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencessixteen personality factor questionnaireunited states national library of medicine