Words Containing: E,E,P,Y
(In Any Order)
There are 2,679 words,
2,416 phrases and
0 abbr's with
E,E,P,Y in.
Best Scoring Words With: E,E,P,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| epoxyed | 7 | 20 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| pyrexes | 7 | 19 | nounn | |||||
noun • a borosilicate glass with a low coefficient of expansion; used for heat-resistant glassware in cooking and chemistry | ||||||||
| jeepney | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| pinkeye | 7 | 16 | nounn | |||||
noun • inflammation of the conjunctiva of the eye | ||||||||
| peppery | 7 | 16 | adjectiveadj | |||||
adjective satellite • having the piquant burning taste of peppers | ||||||||
| empyema | 7 | 16 | nounn | |||||
noun • a collection of pus in a body cavity (especially in the lung cavity) | ||||||||
| popeyed | 7 | 15 | adverb, adjectiveadv, adj | |||||
adjective satellite • with eyes or mouth open in surprise • having bulging eyes | ||||||||
| replevy | 7 | 15 | verbv | |||||
noun • Replevin verb • To return goods to their rightful owner by replevin; to recover goods. • To bail. | ||||||||
| ycleped | 7 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| prythee | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (48)
presleydempseyeyedropsteeplypinkeyetypesetspleenyretypedpepperypopeyedeyespotreplevyeupepsyyclepedyelpersneotypeectypesemployepreyerspyrenespyrexesprytheepolyeneeyecupsecotypeepoxyedpedleryjeepneypeaveyspeyotespeytrelpretypeempyemaretypesyperite
...View all with 7 letters...
Phrases (2)
pay heedper yearWords (114)
employeeemployedemployerepilepsytypefacespeedwaypyreneesexpertlyspeedilyteletypeeyepieceneophytesleepilyparleyedepiphytetenpennyeyepatchempyreanredeployempyrealepistyleemployespurveyedparleyeroverhypedeprenylphoneyedpeddleryhypogenecreepilyhyperopecypheredcypselaeecotypesreemploy
...View all with 8 letters...
Phrases (5)
caley peakeep awaynew pennylady peelleap yearWords (192)
perfectlypreciselypresentlyspeakeasyexemplarytelepathyarchetyperepaymentexpresslyemphysemapolyestersupremelyperipheryhyperbolepolythenehyphenatereputedlyrepertoryperfumerytelephonyphenotypepeaceablytypewritehyperemiahyperemicspeechifystenotypepensivelypederastypropylenepriestleyexemplifytruepennyrepayablepelecypod
...View all with 9 letters...
Phrases (23)
keep relayspeech daypenny antepaul heyseepoxy gluetype genustype metalbeef pattypineal eyedeep fryer
...View all with 9 letters...
Words (293)
completelyespeciallyunemployedemploymentscreenplaypeacefullyrepeatedlyseparatelytypewriterpreferablypresidencyhopelesslyhyperspacedeploymentstereotypesleepyheadreportedlyexpresswayexpectancycyberspacehelplesslydependencyeyedropperperpetuitypresbyteryhypotenuseperversitycompetencysheepishlyepicondylethreepennyperverselyhypertensepermanencyhyphenated
...View all with 10 letters...
Phrases (43)
epoxy resinprivate eyeby the pieceapple jellyemery paperrole playerkey patternexpress joyeye dropperpaper money
...View all with 10 letters...
Words (362)
desperatelypermanentlyprematurelypsychedelichypermarkethyperactiveperpetuallyhorseplayerserendipitybathyspherepolystyrenedeceptivelypersnicketyexpedientlyexpensivelyexplosivelystereotypedthermopylaecompetentlydespondencypsychedeliaoverpaymentrepulsivelypennyweightnephrectomyexpectantlyhypotensivetypesettingteenybopperrespectablyimperfectlyhypothesizetypewrittenhymenopterahepatectomy
...View all with 11 letters...
Phrases (76)
keep an eye onpay envelopecypress vineopen societyflute playerbeauty sleeppeace symbolpeace treatychess playermeryl streep
...View all with 11 letters...
Words (411)
unemploymentunexpectedlychemotherapyrespectfullypenitentiaryencyclopediahypertensionrespectivelyperipherallypresbyterianpersistentlytheophyllinehypertensiveunemployableappendectomyphenomenallyphylogeneticpejorativelyimpressivelypolyurethanehypothesizedstereotypinghyperthermiaarcheopteryxhyperkalemiarespirometryepidemiologydepressinglyencyclopedicredeploymentsupersensoryhyperkineticexemplifyingdespitefullypseudocyesis
...View all with 12 letters...
Phrases (99)
backspace keyathletic typebarbary sheeppoverty levelgenus apteryxgenus cyperusreal propertytennis playerin perpetuitypetit larceny
...View all with 12 letters...
Words (353)
exceptionallyindependentlyprogressivelyexponentiallycomplementarysupplementarystereotypicalexpeditionaryimperceptiblyencyclopaediadependabilitycompetitivelyarchaeopteryxpredominatelyhypercalcemiaincompetentlypicturesquelyhyperglycemicinexpensivelyexpeditiouslysuperlativelyinexpressiblyunrepentantlyperspectivelyimpertinentlypretentiouslyhypertrophiedhypervelocitypneumonectomyencyclopaedicdaguerreotypeprecipitatelypolypropylenepenetratinglyresplendently
...View all with 13 letters...
Phrases (132)
spiny anteaterholy sepulcherholy sepulchreprivate treatyfamily poaceaetaste propertyproperty ownergenus gypaetusbattle of ypresjapanese deity
...View all with 13 letters...
Words (333)
respectabilityhypersensitiveinterplanetarypancreatectomyelectrotherapyhyperventilateexperimentallymetempsychosistelepathicallyreproductivelyencephalopathyappreciativelyappendicectomypyelonephritisdepartmentallytelephonicallypreferentiallypreposterouslyoverpoweringlyimpermeabilityempatheticallypreponderantlycyproheptadinecomprehensiblydepolymerizinghyperkeratoticbutyrophenoneshypermasculinepolybutadieneshypermetropiashypoallergenicpolynucleotideheterophyllousextemporaneityhyperpigmented
...View all with 14 letters...
Phrases (149)
family apiaceaepearl mae baileynavy departmentpolymeric amideprimary featherlacrosse playerchinese parsleydizzy gillespiemost especiallyjapanese cherry
...View all with 14 letters...
Words (222)
disrespectfullydevelopmentallyparentheticallyplenipotentiarytherapeuticallymethylphenidateencephalographyphotosynthesizepostoperativelyintrospectivelyuninterruptedlyretrospectivelyunprecedentedlyeuphemisticallycomprehensivelytemperamentallydiphenhydramineinterdependencyperpendicularlyhypersensitizedcontemplativelyemployabilitiesteletypewriterscomplementaritymegagametophytepsychedelicallypoliomyelitidesserendipitouslyhyperaggressiveperipateticallysculpturesquelycyproheptadineshypersomnolencehyperstimulatedhyperstimulates
...View all with 15 letters...
Phrases (182)
class pelecypodaalimentary pasteebony spleenwortprivate propertyfamily leporidaeorycteropus aferpsychotic beliefspiny-headed wormpipeline companygempylus serpens
...View all with 15 letters...
Words (132)
incomprehensiblytriphenylmethanehyperintelligenthyperventilationphylogeneticallyimperceptibilityelectromyographysphygmomanometerextemporaneouslyhypersensitivitypolydispersitiespolyelectrolytesheterokontophytahymenophyllaceaeparaformaldehydeextracorporeallyhypersensitizingmicrogametophytenoncompetitivelyhypersexualitieshypersomnolencesimperfectibilityantiunemploymenthypersusceptibleapocryphalnesseshyperventilatinghyperviscositieshypervitaminoseshypophysectomieshypophysectomiseleukodystrophiesperpendicularityhypophysectomizecryopreservationlyginopteridales
...View all with 16 letters...
Phrases (209)
hypodermic needletympanic membranefamily cyperaceaeefficiency expertautogenic therapyvolleyball playerexemplary damagescalystegia sepiumgenus aptenodytesquaternary period
...View all with 16 letters...
Words (72)
perchloroethylenecontemporaneouslypsychotherapeutichyperreactivitiesphysiotherapeuticcercidiphyllaceaeparaformaldehydesthermoperiodicityspectrophotometryhyperventilationssphygmomanometershypophysectomizeshypophysectomisedmorphogeneticallyhypophysectomizedcryopreservationsencephalomyelitispentylenetetrazoldisrespectabilitylymphadenopathieshyperalimentationstereospecificitythiodiphenylaminephenylethylaminesstereophotographynephelometricallysamoyedic-speakingtriphenylmethaneshyperintelligenceneurophysiologiesphosphoglyceratesneuropsychiatrieselectromyographicneuropsychologiessuperheavyweights
...View all with 17 letters...
Phrases (244)
gopherus polypemusmary leontyne priceproteolytic enzymehypoglycemic agentpearly everlastingclass rhodophyceaecylinder separatorfamily didelphidaepetasites hybridusinvestment company
...View all with 17 letters...
Words (41)
hyperaldosteronismhypersensitivenesspolyesterificationspectrofluorometryhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticssphygmomanometriespentylenetetrazolsperchloroethyleneshyperbilirubinemiastereospecificallypteridospermaphytahypercholesteremiamyeloproliferativephenomenologicallygranulocytopoiesespolypropenonitrilerepresentationallyelectromyographieselectrooculographymethylnaphthaleneselectrophotographyelectrophysiologicmethylprednisolonepropertylessnessescryptogrammataceaepseudonymousnessespseudoparenchymatacounterdeploymentshyperalimentationssemiprofessionally
...View all with 18 letters...
Phrases (229)
family physeteridaeperomyscus leucopusread-only memory chipkilocycle per secondsuperiority complexfamily asparagaceaemegacycle per secondfamily polygalaceaevictory in europe daycapital of new jersey
...View all with 18 letters...
Words (31)
polyesterificationshypersensitizationspolyribonucleotideshypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallycytopathogenicitiesphenomenalisticallyphenylthiocarbamideechoencephalographyphosphoenolpyruvateinterdepartmentallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistelectroretinographyincomprehensibilityencephalomyelitidesphenylpropanolamineoverproportionatelyhyperconcentrationshyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiespaleogeographicallyexpressionisticallymedroxyprogesteroneelectrocardiographyPhrases (205)
family cyclopteridaealpine type of glacierfamily lepisosteidaefamily tropaeolaceaefamily polypodiaceaehydrobates pelagicussubfamily mephitinaesubfamily perdicidaejapanese honeysuckleunix operating system
...View all with 19 letters...
Words (18)
hypercholesterolemiahypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismphenylpropanolaminesphenylthiocarbamidesphosphoenolpyruvateshyperlipoproteinemiaelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoushypercholesterolemichypercoagulabilitieshyperconsciousnessesPhrases (169)
wyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaedevelopmental anatomyfamily pseudococcidaefriendly relationshipjapanese monetary unitclosure by compartmentamyloid protein plaque
...View all with 20 letters...
Words (7)
hypersusceptibilitiesstereomicroscopicallyphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydehypercholesterolemiaspsychotherapeuticallyPhrases (147)
extrauterine pregnancypseudemys rubriventriseucalyptus fraxinoidesptolemy ii philadelphusprocaine hydrochloridefamily myrmecophagidaespeech intelligibilitycape verde monetary unitphylum platyhelmintheswhite-coat hypertension
...View all with 21 letters...
Words (9)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydeselectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (117)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathyhigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricitynyctereutes procyonides
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (76)
meperidine hydrochlorideyellowstone national parkparis-sorbonne universityeuropean recovery programgroup pteridospermaphytatricyclic antidepressanteastern malayo-polynesianchrysanthemum partheniumdepartment of the treasuryamerican federalist party
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (59)
argyroxiphium sandwicensedivision heterokontophytaprivately held corporationprimary sex characteristicexistentialist philosophyfederal republic of germanyhypersensitivity reactionchrysosplenium americanumhaematoxylum campechianumanal retentive personality
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (44)
myroxylon balsamum pereiraemodest petrovich mussorgskypropoxyphene hydrochloridemelanerpes erythrocephalustrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentsuborder petromyzoniformeslepidocybium flavobrunneumhormone-replacement therapy
...View all with 25 letters...
Phrases (44)
employee stock ownership planbureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosussuperorder labyrinthodontialeptodactylus pentadactylusnontricyclic antidepressantintermediate temporal arterycalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (32)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanapull the wool over someone's eyesdeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatethyrotropin-releasing hormone
...View all with 27 letters...
Phrases (26)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidemicrosoft disk operating systemdepartment of homeland securitydissident irish republican armyface-amount certificate companyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphism
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (18)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity tester
...View all with 29 letters...
Phrases (21)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencebalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositionfrequency-response characteristicPhrases (10)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economypositron emission tomography scannersubacute inclusion body encephalitisphysiological jaundice of the newbornPhrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdefense advanced research projects agencysixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn
