Words Containing: E,E,P,T,Y
(In Any Order)
There are 1,680 words,
1,555 phrases and
0 abbr's with
E,E,P,T,Y in.
Best Scoring Words With: E,E,P,T,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| prythee | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
| ectypes | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| tepefy | 6 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| ecotype | 7 | 14 | nounn | |||||
noun • A phenotype that is adapted to a specific environment. | ||||||||
| pretype | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| retyped | 7 | 13 | verbv | |||||
verb • To re-enter (text) using a keyboard. | ||||||||
| ectype | 6 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| steeply | 7 | 12 | adverbadv | |||||
adverb • in a steep manner | ||||||||
| typeset | 7 | 12 | verbv | |||||
verb • set in type | ||||||||
| eyespot | 7 | 12 | nounn | |||||
noun • an eyelike marking (as on the wings of some butterflies); usually a spot of color inside a ring of another color | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (46)
typefaceexpertlyteletypeneophyteepiphytetenpennyeyepatchepistyleecotypeseyespotsyperitesserotypepetabytepedatelycerotypeclypeatetypeabletypecasetypesetspolyteneperipetypettedlyneotypeseyepointpeytrelsgeophyteantetypeteleplaypretypedpretypesteenybopgenotypepterylaeovertypehypnotee
...View all with 8 letters...
Words (91)
perfectlypresentlytelepathyarchetyperepaymentpolyesterpolythenehyphenatereputedlyrepertorytelephonyphenotypetypewritestenotypepederastypriestleytruepennyappetencyaerophytepolycheteserotypespetrogenycerotypestypefacestypewroteoutyelpedneophytesproselytepresbyterperistyleteleplaysferrotypepetabytesencryptedmesophyte
...View all with 9 letters...
Phrases (5)
penny antetype genustype metalbeef pattytree poppyWords (137)
completelyemploymentrepeatedlyseparatelytypewriterdeploymentstereotypereportedlyexpectancyperpetuitypresbyteryhypotenuseperversitycompetencythreepennyhypertensehyphenatedperemptoryprepaymentpernicketyinexpertlytelegraphytypesetterperplexityredemptorypenitentlypertinencyphlyctenaeratepayershypothesesphenotypeshepatocyterepaymentspolyesterspreceptory
...View all with 10 letters...
Phrases (15)
private eyeby the piecekey patternhappy eventstep-by-stepepic poetrytape playertorrey pinedeep-fat-frygreen party
...View all with 10 letters...
Words (208)
desperatelypermanentlyprematurelyhypermarkethyperactiveperpetuallyserendipitybathyspherepolystyrenedeceptivelypersnicketyexpedientlystereotypedthermopylaecompetentlyoverpaymentpennyweightnephrectomyexpectantlyhypotensivetypesettingteenybopperrespectablyimperfectlyhypothesizetypewrittenhymenopterahepatectomypersistencyextemporarypervertedlyherpetologypresentablyreceptivityproselytize
...View all with 11 letters...
Phrases (32)
open societyflute playerbeauty sleeppeace treatymeryl streeptake-home paypearl oystercrape myrtletype speciesrobert peary
...View all with 11 letters...
Words (254)
unemploymentunexpectedlychemotherapyrespectfullypenitentiaryhypertensionrespectivelypresbyterianpersistentlytheophyllinehypertensiveappendectomyphylogeneticpejorativelypolyurethanehypothesizedstereotypinghyperthermiaarcheopteryxrespirometryredeploymenthyperkineticdespitefullyrehypnotizedincompetencyperceptivelypermeabilityperemptorilyspectrometryrepetitivelypolyethyleneincompletelyimperativelyephemeralitydepreciatory
...View all with 12 letters...
Phrases (53)
athletic typepoverty levelgenus apteryxreal propertytennis playerin perpetuitypetit larcenyfifty percenttenpenny nailheroic poetry
...View all with 12 letters...
Words (234)
exceptionallyindependentlyexponentiallycomplementarysupplementarystereotypicalexpeditionaryimperceptiblydependabilitycompetitivelyarchaeopteryxpredominatelyincompetentlypicturesquelyexpeditiouslysuperlativelyunrepentantlyperspectivelyimpertinentlypretentiouslyhypertrophiedhypervelocitypneumonectomydaguerreotypeprecipitatelypenetratinglyresplendentlypresumptivelyencyclopedistpenetrabilityhypermetropiaintemperatelypenitentiallypsychogeneticspermatophyte
...View all with 13 letters...
Phrases (66)
spiny anteaterprivate treatytaste propertyproperty ownergenus gypaetusbattle of ypresjapanese deitymemory pictureheavy particlegenus physeter
...View all with 13 letters...
Words (246)
respectabilityhypersensitiveinterplanetarypancreatectomyelectrotherapyhyperventilateexperimentallymetempsychosistelepathicallyreproductivelyencephalopathyappreciativelyappendicectomypyelonephritisdepartmentallytelephonicallypreferentiallypreposterouslyimpermeabilityempatheticallypreponderantlycyproheptadinehyperkeratoticbutyrophenonespolybutadieneshypermetropiaspolynucleotideheterophyllousextemporaneityhyperpigmentedsupereminentlypyrimethaminespresentabilityhyperrealisticexploitatively
...View all with 14 letters...
Phrases (79)
navy departmentprimary feathermost especiallylife expectancyfifty-cent piecegenus pyrethrumliterary periodtheater companytrombone playercomputer memory
...View all with 14 letters...
Words (167)
disrespectfullydevelopmentallyparentheticallyplenipotentiarytherapeuticallymethylphenidatephotosynthesizepostoperativelyintrospectivelyuninterruptedlyretrospectivelyunprecedentedlyeuphemisticallytemperamentallyinterdependencyhypersensitizedcontemplativelyemployabilitiesteletypewriterscomplementaritymegagametophytepoliomyelitidesserendipitouslyperipateticallysculpturesquelycyproheptadineshyperstimulatedhyperstimulatesdaguerreotypisthypercorrectionhyperexcitementpolynucleotidestelegraphicallylepidopterologyinterpersonally
...View all with 15 letters...
Phrases (101)
alimentary pasteebony spleenwortprivate propertyorycteropus aferpsychotic belieflymphatic vesselmagnetic pyritesgenus eucalyptusspeech communityexpressive style
...View all with 15 letters...
Words (112)
triphenylmethanehyperintelligenthyperventilationphylogeneticallyimperceptibilityelectromyographysphygmomanometerextemporaneouslyhypersensitivitypolydispersitiespolyelectrolytesheterokontophytaextracorporeallyhypersensitizingmicrogametophytenoncompetitivelyhypersexualitiesimperfectibilityantiunemploymenthypersusceptiblehyperventilatinghyperviscositieshypervitaminoseshypophysectomieshypophysectomiseleukodystrophiesperpendicularityhypophysectomizecryopreservationlyginopteridalesstereophonicallystereoscopicallycytophotometriespiezoelectricitydaguerreotypists
...View all with 16 letters...
Phrases (144)
tympanic membraneefficiency expertautogenic therapycalystegia sepiumgenus aptenodytesquaternary periodgenus phytelephasprince albert's yewpersonal propertyegyptian language
...View all with 16 letters...
Words (63)
perchloroethylenecontemporaneouslypsychotherapeutichyperreactivitiesphysiotherapeuticthermoperiodicityspectrophotometryhyperventilationssphygmomanometershypophysectomizeshypophysectomisedmorphogeneticallyhypophysectomizedcryopreservationsencephalomyelitispentylenetetrazoldisrespectabilitylymphadenopathieshyperalimentationstereospecificitythiodiphenylaminephenylethylaminesstereophotographynephelometricallytriphenylmethaneshyperintelligencephosphoglyceratesneuropsychiatrieselectromyographicsuperheavyweightsmethylnaphthalenecomprehensibilitycarboxypeptidaseselectrophysiologypetromyzoniformes
...View all with 17 letters...
Phrases (141)
mary leontyne priceproteolytic enzymehypoglycemic agentpearly everlastingcylinder separatorpetasites hybridusinvestment companyhereditary patternindependent agencypenetrating injury
...View all with 17 letters...
Words (35)
hyperaldosteronismhypersensitivenesspolyesterificationspectrofluorometryhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidepsychotherapeuticssphygmomanometriespentylenetetrazolsperchloroethylenesstereospecificallypteridospermaphytahypercholesteremiamyeloproliferativegranulocytopoiesespolypropenonitrilerepresentationallyelectromyographieselectrooculographymethylnaphthaleneselectrophotographyelectrophysiologicmethylprednisolonepropertylessnessescryptogrammataceaepseudoparenchymatacounterdeploymentshyperalimentationshyperconcentrationhypercorrectnessesdimethyltryptaminehyperpigmentationshyperrationalitiesPhrases (143)
family physeteridaesuperiority complexvictory in europe daycapital of new jerseyherman northrop fryerespiratory illnessgenus archaeopteryxphoenix dactyliferanycticebus pygmaeusparliamentary agent
...View all with 18 letters...
Words (28)
polyesterificationshypersensitizationspolyribonucleotideshypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallycytopathogenicitiesphenomenalisticallyphenylthiocarbamidephosphoenolpyruvateinterdepartmentallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistelectroretinographyincomprehensibilityencephalomyelitidesoverproportionatelyhyperconcentrationshyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiesexpressionisticallymedroxyprogesteroneelectrocardiographyPhrases (133)
family cyclopteridaealpine type of glacierfamily lepisosteidaefamily tropaeolaceaehydrobates pelagicussubfamily mephitinaeunix operating systemcapital of seychellesorder apterygiformesstrawberry preserves
...View all with 19 letters...
Words (16)
hypercholesterolemiahypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismphenylthiocarbamidesphosphoenolpyruvateshyperlipoproteinemiaelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoushypercholesterolemichypercoagulabilitiesPhrases (121)
wyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaedevelopmental anatomyfriendly relationshipjapanese monetary unitclosure by compartmentamyloid protein plaqueglycerol tripalmitate
...View all with 20 letters...
Words (5)
hypersusceptibilitiesstereomicroscopicallyelectromyographicallyhypercholesterolemiaspsychotherapeuticallyPhrases (111)
extrauterine pregnancypseudemys rubriventriseucalyptus fraxinoidesptolemy ii philadelphusspeech intelligibilitycape verde monetary unitphylum platyhelmintheswhite-coat hypertensionsuperfamily tyrannidaebattle of cynoscephalae
...View all with 21 letters...
Words (7)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (92)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathyhigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricitynyctereutes procyonides
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (54)
yellowstone national parkparis-sorbonne universitygroup pteridospermaphytatricyclic antidepressanteastern malayo-polynesianchrysanthemum partheniumdepartment of the treasuryamerican federalist partyartocarpus heterophylluswestern malayo-polynesian
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (45)
division heterokontophytaprivately held corporationprimary sex characteristicexistentialist philosophyhypersensitivity reactionhaematoxylum campechianumanal retentive personalityelectroconvulsive therapypelecanus erythrorhynchossuperior cerebellar artery
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (37)
modest petrovich mussorgskymelanerpes erythrocephalustrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentsuborder petromyzoniformeshormone-replacement therapypodkamennaya tunguska riverdevelopmentally challengedspecial theory of relativity
...View all with 25 letters...
Phrases (36)
employee stock ownership planbureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosussuperorder labyrinthodontialeptodactylus pentadactylusnontricyclic antidepressantintermediate temporal arteryclosed-end investment company
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (27)
augustus welby northmore puginco-operative republic of guyanapull the wool over someone's eyesdeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteininformation processing system
...View all with 27 letters...
Phrases (22)
revolutionary people's struggletriphosphopyridine nucleotidemicrosoft disk operating systemdepartment of homeland securitydissident irish republican armyface-amount certificate companyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismaspidophoroides monopterygius
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibrium
...View all with 29 letters...
Phrases (21)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencebalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositionfrequency-response characteristicPhrases (10)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economypositron emission tomography scannersubacute inclusion body encephalitisphysiological jaundice of the newbornPhrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdefense advanced research projects agencysixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn
