Words Containing: E,E,G,Y
(In Any Order)
There are 1,375 words,
1,815 phrases and
0 abbr's with
E,E,G,Y in.
Best Scoring Words With: E,E,G,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jaygees | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| jaygee | 6 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
| hygiene | 7 | 14 | nounn | |||||
noun • a condition promoting sanitary practices • the science concerned with the prevention of illness and maintenance of health | ||||||||
| bogeyed | 7 | 14 | verbv | |||||
noun • a bogle or goblin; where used as a proper name, the Devil • (golf) a score of one stroke over par on a hole • an unidentified (and possibly enemy) aircraft verb • to shoot in one stroke over par | ||||||||
| frogeye | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| greyhen | 7 | 14 | nounn | |||||
noun • female black grouse | ||||||||
| yeggmen | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| regency | 7 | 13 | nounn | |||||
noun • the period from 1811-1820 when the Prince of Wales was regent during George III's periods of insanity • the period of time during which a regent governs • the office of a regent | ||||||||
| geeky | 5 | 13 | adjectiveadj | |||||
adjective • Resembling or characteristic of a geek. | ||||||||
| bigeyes | 7 | 13 | ||||||
noun • red fishes of American coastal tropical waters having very large eyes and rough scales | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (68)
eyesightgeometrygreenerygreenwayganymedegreedilyhegemonyguernseyedgewaysmegabyteexigencyeyeglassgreenflydelegacymeagerlymeagrelylegeritygreyhensredyeingzymogeneelegancyhypogenegayetiespolygenegoldeyeslegendrygynaecearekeyingengineryungreedyfrogeyedfrogeyesgruyeresgreynesscymogene
...View all with 8 letters...
Phrases (13)
zane greyegg yieldmagic eyejelly egggrey areaglass eyegrey sagegrey solegreek keygreen bay
...View all with 8 letters...
Words (124)
emergencygenerallylegendarygenuinelyseeminglyallegedlyelegantlygenealogyglycerinegleefullyaveragelyoxygenatealleghenyfeelinglygreystoneremedyinggenteellygreybeardagreeablygoldeneyejeeringlyoxygenizeglueynessglycerideweepinglyteleologyexigentlyclergymenoxygenasefeignedlypetrogenyenragedlysyngeneicuneagerlypolygenes
...View all with 9 letters...
Phrases (16)
turkey legivy leaguegerm layermealy sageepoxy gluetype genusgreat yeargrey aldergene kellygrey skate
...View all with 9 letters...
Words (167)
everythinggenerositygenerouslynegativelygooseberryeyeglassesoxygenateddegeneracygruesomelyoxygenizedtelegraphyfleetinglygeneralitysneeringlydesignedlysynergeticdetergencydivergencyheterogenyhoneyguideregeneracyreedifyingpresurgeryepeirogenyglycerideseyeballingsweepinglyoverdyeingselenologybewearyingreenjoyingfleeringlyfreezinglyresignedlyvengefully
...View all with 10 letters...
Phrases (40)
energy unitgrey mattergreek deityivy leaguerleydig cellgrace kellygrape jellyfree agencyfree energyin a pig's eye
...View all with 10 letters...
Words (207)
geneticallyheavyweightsovereigntyexceedinglyregrettablygentlemanlyregretfullymeteorologyinteragencygrotesquelypennyweightdeservinglydemagoguerytypesettingegregiouslyhomogeneitydelightedlyreflexologynegligentlysteeragewayherpetologysuperagencygenericallydeafeninglylegendarilydeceivinglyyesternightetymologiseunfeelinglyunfeignedlyendearinglyconvergencygracelesslycytogeneticrevealingly
...View all with 11 letters...
Phrases (59)
genus myxineenergy levelroentgen rayhoney badgersingle entryledger entrymemory imagemelange yarngenus hyaenaevelyn waugh
...View all with 11 letters...
Words (216)
aggressivelytriglycerideneurosurgerylegitimatelyelectrifyingrefreshinglybelligerencyphylogeneticstereotypingepidemiologyhydrogenateddepressinglysuggestivelyexemplifyingweightlesslydeoxygenatedgreengroceryagreeabilityrevengefullycyanogeneticentreatinglyhepatomegalybeseechinglyheterodyningreliquefyingungenerosityungenerouslyneglectfullyregardlesslygerrymandersregeneratelyoverwearyingretestifyingetymologisedetymologized
...View all with 12 letters...
Phrases (78)
genus glycinehockey leaguefully fledgedgenus apteryxgenus cyperusgenus eucaryaeleanor gwynncasey stengelgenus torreyabridge player
...View all with 12 letters...
Words (158)
interestinglyprogressivelyintelligentlyeverlastinglydehydrogenaseenergeticallyungentlemanlydeoxygenationhyperglycemicunrelentinglymeaninglesslygeometricallyroentgenologyoverbearinglydaguerreotypethreateninglybelligerentlypenetratinglyunbelievinglyintegumentarybewilderinglydemythologizepsychogeneticheterogeneitypostemergencygerrymanderedallergenicitygymnospermieselectrotypingknowledgeablyrekeyboardingperseveringlyoverweeninglydeprecatinglyegocentricity
...View all with 13 letters...
Phrases (121)
neglect of dutywaste of energygenus cyclamengenus gypaetusradiant energyheavy hydrogengenus nymphaeagenus erysimumthree kings' daygenus physeter
...View all with 13 letters...
Words (161)
overwhelminglycytogeneticistnitroglycerinegovernmentallyelectromyogramentertaininglydemythologisedanesthesiologyoverpoweringlyillegitimatelydemythologizeddepolymerizinggenerationallylightheartedlyheterozygositydehydrogenasesgreatheartedlyhypoallergenicgenealogicallyegocentricallyhyperpigmentedacceleratinglyelectrosurgeryovergenerouslyexasperatinglyteleologicallypseudepigraphydaguerreotypeddaguerreotypesremythologizedremythologizeshypervigilanceresynthesizingpaleogeographybiometeorology
...View all with 14 letters...
Phrases (142)
emergency brakevolleyball gamedrainage systemdizzy gillespieoyster dressingtattletale greygenus pyrethrumgenus aepycerosanser cygnoidesgenus euthynnus
...View all with 14 letters...
Words (111)
anaesthesiologycondescendinglyencephalographyheartbreakinglyinterrogativelyheterogeneouslymegagametophyteunintelligentlyretrogressivelynonbelligerencydishearteninglyhyperaggressivedaguerreotypisthypercoagulablenitroglycerineshypervigilancesresystematizingcytogeneticistselectromyogramstelegraphicallylepidopterologyroentgenographystereologicallyontogeneticallyelectromyographdemythologizersdehydrogenatingdehydrogenationphototelegraphygeomagneticallytelephotographyoveridentifyingglutaraldehydeseasygoingnessesepeirogenically
...View all with 15 letters...
Phrases (174)
benefit of clergysystem of weightsleveraged buyoutgempylus serpensgenus eriobotryageneral assemblymagnetic pyritesgenus eucalyptusgenus menyantheshighly infective
...View all with 15 letters...
Words (46)
hyperintelligentphylogeneticallyelectromyographysphygmomanometerhypersensitizingmicrogametophytethermoregulatorydimethylglyoximehyperventilatinglyginopteridalesflibbertigibbetygastroenterologystereoregularitycytotechnologiesdaguerreotypistsoligodendrocytesgeneralizabilitysyncategorematicorthogeneticallydehydrogenationsmegagametophytesphosphoglycerateelectromyographsmetapsychologiessuperheavyweightheterozygositiesmyelomeningocelethermogravimetrypalaeodendrologymicrogametocyteslawfully-begottenmeteorologicallymicrometeorologyphototypesettinghydrometeorology
...View all with 16 letters...
Phrases (173)
commercial agencyautogenic therapyexemplary damagesyeoman of the guardcalystegia sepiumgenus aptenodytesisland of guernseyorder polygonalesgrand mal epilepsynyamwezi language
...View all with 16 letters...
Words (29)
counterinsurgencyunexchangeabilitysphygmomanometersferrimagneticallymorphogeneticallygastroenterostomycytomegalovirusesimmunogeneticallyelectronegativitystereophotographysamoyedic-speakinghyperintelligenceneurophysiologiesphosphoglycerateselectrometallurgyelectromyographicneuropsychologiessuperheavyweightselectrophysiologyhyperpigmentationpalaeoethnographyuncomprehendinglyepidemiologicallyhydrometallurgiesepistemologicallyphototypesettingsdihydroergotamineplethysmographiespaleomagneticallyPhrases (185)
dame margot fonteyngopherus polypemushypoglycemic agentinterstate highwaypearly everlastingcoccygeal vertebratheological systemgettysburg addressyeniseian languagegreater yellowlegs
...View all with 17 letters...
Words (18)
interchangeabilityspectroheliographysphygmomanometriesmagnetostrictivelyphenomenologicallyneuroendocrinologygranulocytopoieseselectromyographieselectrooculographyelectrophotographyelectrophysiologicroentgenologicallycryptogrammataceaesedimentologicallyhydrometeorologieshydrometeorologistdihydroergotamineshyperpigmentationsPhrases (180)
family asparagaceaemegacycle per secondfamily polygalaceaegenus chamaecytisusfamily magnoliaceaegene delivery vectorgossypium herbaceumwedding anniversarygenus archaeopteryxfamily meliphagidae
...View all with 18 letters...
Words (12)
parthenogeneticallycytopathogenicitiesechoencephalographyelectromagneticallyelectrophysiologieselectrophysiologistelectroretinographyhydrometeorologicalhydrometeorologistspaleogeographicallymedroxyprogesteroneelectrocardiographyPhrases (108)
alpine type of glaciergiles lytton stracheyhydrobates pelagicusunix operating systemfamily zingiberaceaeorder apterygiformesgerard manley hopkinsintegumentary systemglycerinated gelatinfamily geoglossaceae
...View all with 19 letters...
Words (6)
polyphiloprogenitiveelectrophysiologicalelectrophysiologistsroentgenographicallysyncategorematicallyhypercoagulabilitiesPhrases (102)
byelorussian languagemagnetic bubble memoryclassifying adjectivefamily gasterosteidaemilitary intelligencelaw enforcement agencyglycerol tripalmitateegyptian monetary unitfamily gleicheniaceaephylogenetic relation
...View all with 20 letters...
Words (3)
phosphoglyceraldehydeelectromyographicallyantiferromagneticallyPhrases (82)
extrauterine pregnancynorwegian monetary unitstrawberry haemangiomasoren aabye kierkegaardsamuel taylor coleridgefamily myrmecophagidaespeech intelligibilityhans holbein the youngerreconstructive surgeryfamily grossulariaceae
...View all with 21 letters...
Words (3)
electroencephalographyphosphoglyceraldehydeselectrophysiologicallyPhrases (68)
high-density lipoproteinguatemalan monetary unitguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencetroglodytes troglodytesdoctor of sacred theologynotemigonus crysoleucasedward kennedy ellington
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (46)
carnegie mellon universityargyroxiphium sandwicenseunidentified flying objectzollinger-ellison syndromesir terence mervyn rattiganfederal republic of germanyhenry wadsworth longfellowandrei andreyevich gromykopaul johann ludwig von heyseposterior meningeal artery
...View all with 24 letters...
Phrases (24)
diamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngereligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigades
...View all with 25 letters...
Phrases (24)
brassica oleracea gongylodeshunting and gathering societyevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndromecircumflex artery of the thigh
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (27)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Phrases (17)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonecentral intelligence machinery
...View all with 28 letters...
Phrases (9)
disorganized type schizophreniaautomatic data processing systemedward george earle bulwer-lyttonhydrangea macrophylla hortensisnational intelligence communityfrancisco jose de goya y lucientespressure-feed lubricating systemenvironmental protection agencyimaginary part of a complex numberPhrases (9)
diego rodriguez de silva y velazquezport-access coronary bypass surgeryrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityhuygens' principle of superpositiondefense information systems agencymary godwin wollstonecraft shelleyPhrases (9)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisfederal emergency management agencyattorney general of the united statesbosnian-herzegovinian monetary unitPhrases (10)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
