Words Containing: C,S,T,Y
(In Any Order)
There are 4,049 words,
2,591 phrases and
0 abbr's with
C,S,T,Y in.
Best Scoring Words With: C,S,T,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| sketchy | 7 | 19 | adjectiveadj | |||||
adjective satellite • giving only major points; lacking completeness | ||||||||
| kitschy | 7 | 19 | adjectiveadj | |||||
adjective satellite • effusively or insincerely emotional | ||||||||
| shticky | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chymist | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| smutchy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| tricksy | 7 | 16 | adjectiveadj | |||||
adjective satellite • marked by skill in deception | ||||||||
| scythed | 7 | 16 | verbv | |||||
noun • an edge tool for cutting grass; has a long handle that must be held with both hands and a curved blade that moves parallel to the ground verb • cut with a scythe | ||||||||
| sticky | 6 | 15 | adjectiveadj | |||||
adjective satellite • having the sticky properties of an adhesive • moist as with undried perspiration and with clothing sticking to the body • hot or warm and humid • hard to deal with; especially causing pain or embarrassment • covered with an adhesive material | ||||||||
| christy | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| stocky | 6 | 15 | adjectiveadj | |||||
adjective satellite • having a short and solid form or stature | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
cystWords (73)
societycustodycrystalecstasychristysketchytuscanycyclistcurtseykitschycopyistcocytusstarchystypticscythiasnitchytricksysectaryclysterencystsscythedcygnetstycoonsoocytescurtesystenchychymistcysteincitrusyectypessnatchymyoticsscythesoocyststestacy
...View all with 7 letters...
Phrases (5)
tea cosysun citycat's eyest. cyrilstick byWords (163)
securitysecretlystrictlycourtesypussycatmysticalcasualtychastityhaystacksanctityscrutinystracheyancestrycatalystscarcityscratchysystemicjoystickhystericsynapticcastawaylyricistsacristysanctifystretchycystitissystolicdystonicscythiansynopticcorsetrydynastictypecastcytosinesagacity
...View all with 8 letters...
Phrases (7)
boy scoutsoft copypyx chesttest copytoy chestcity deskcast awayWords (316)
secretarychemistrycuriosityspecialtypsychoticsanctuarynecessitysinceritysyntheticphysicistsyndicateecosystemcustomarycataclysmobscenityobscurityhystericsvasectomymysticismsymbioticobstinacycolostomyskyrocketcausalitygymnasticconstancyyardstickrascalityyachtsmancatalepsyviscosityschmaltzysycophanthesitancycasuistry
...View all with 9 letters...
Phrases (21)
salary cutdry socketcase studyeye socketboy scoutsmason citymercy seatyeast cakepilar cysttipsy cake
...View all with 9 letters...
Words (451)
constantlyhystericalpsychopathgymnasticssimplicityspecialityinsecuritypsychiatrydiscreetlydistinctlysystematiceucalyptuscautiouslystrychninesyndicatedscathinglyelasticitydiscretelysuccinctlymastectomysyndactylyasymmetricmusicalityabstractlysyphiliticsalicylatestringencyisocyanatesociopathysanctimonymetaphysicsyncopatedaccusatoryspasticityunicyclist
...View all with 10 letters...
Phrases (35)
pastry cookst. polycarpmaster copycity limitssafety lockplay trickssystem callsilver citynancy astorstony coral
...View all with 10 letters...
Words (514)
countrysidepsychiatricsympatheticcontroversyconsistencysymmetricaldrasticallyaristocracymasculinitytchaikovskycataclysmicdysfunctionpromiscuityincessantlymetaphysicspyroclasticcrystallinegastrectomyselectivelysymptomaticexclusivityscientologysystematicsconsultancypersnicketysyndicationschenectadyphysicalitycustomarilyseductivelysyncopationcourteouslyhypogastricancestrallysycophantic
...View all with 11 letters...
Phrases (65)
customs dutybicycle seatmystic jewelclosely knitdirty tricksvena cysticacelery stickcoyote stateopen societystock symbol
...View all with 11 letters...
Words (620)
psychiatristpsychologistchristianityindistinctlycontinuouslyrespectfullysufficientlyconservatorysatisfactorygynecologistconsistentlyconsequentlyhistoricallymetaphysicalconstituencypsychopathichystericallybiochemistrymeticulouslytransparencystructurallyartisticallyclytemnestracrystallizedhysterectomyasymmetricalrespectivelyposthypnoticsubjectivitydomesticallymisogynisticastrophysicspyrotechnicsconstabularyelectrolysis
...View all with 12 letters...
Phrases (103)
body stockingvisual acuityscantily cladlickety splitchinese deitychristmas daycost analysisanas clypeataislamic unitywatch crystal
...View all with 12 letters...
Words (602)
significantlyinstinctivelystatisticallydysfunctionalpsychoanalystfantasticallypsychosomaticchrysanthemumgynaecologistpsychotherapyrealisticallystrategicallyspectacularlysarcasticallystereotypicalconsecutivelydiscretionaryunsympatheticaestheticallyinconsistencyidiosyncraticcholecystitissymmetricallyaccessibilitysympathectomysynchronicityantipsychoticmystificationprostatectomypicturesquelystaphylococcidistinctivelyintrinsicallydiscontinuityichthyologist
...View all with 13 letters...
Phrases (124)
aleatory musiccustody battlesystem commandbody structurebody substancecygnus atratusacrylate resinfactor analysecost of qualityscoring system
...View all with 13 letters...
Words (500)
scientificallysystematicallyrespectabilitycytogeneticistundersecretaryastrophysicistunsatisfactorythermodynamicsconservativelypsychoanalyticdiscriminatorychemosynthesiscontemptuouslypsychoneuroticsubcutaneouslysusceptibilitysatisfactorilylinguisticallymetaphysicallymetempsychosisscholasticallydiscourteouslynarcosynthesismicrochemistrystaphylococcusinsufficientlyconstructivelyoptimisticallyastronomicallysuperficialitysimplisticallyidealisticallyaltruisticallydiagnosticallyphotosynthetic
...View all with 14 letters...
Phrases (153)
trionyx muticussabbatical yearabstract entityclassical stylemost especiallychristopher frycombat casualtycapital of syriasocial activitycrime syndicate
...View all with 14 letters...
Words (361)
psychotherapistsynchronizationdisrespectfullyconscientiouslysympathomimeticsynergisticallyinaccessibilitycrystallizationpsychobiologistsynchronisationcontroversiallycytomegaloviruscompassionatelystereochemistryrecrystallizingintrospectivelycholecystectomygastronomicallycrystallographypsychopathologysympatheticallyretrospectivelyinconsideratelyeuphemisticallyritualisticallyneuropsychiatrypessimisticallypsychiatricallyvoyeuristicallysymmetricalnesskinestheticallyinsurrectionaryagranulocytosisunsymmetricallysanctimoniously
...View all with 15 letters...
Phrases (192)
auditory ossiclestay of executioncentaurea cyanusorycteropus aferpsychotic belieflycosa tarentulastonecrop familyfamily astacidaejoyce carol oateslouisa may alcott
...View all with 15 letters...
Words (172)
enthusiasticallyindiscriminatelyconstitutionallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallythermostaticallysurrealisticallyelectrochemistryparapsychologistconversationallyneuropsychiatricdiscriminatorilypolyelectrolytesjurisdictionallyantistrophicallycommensurabilitythermoplasticityparaphrasticallypolysynapticallypositivisticallyhypersusceptibleparasympatheticsmonocotyledonoushyperviscositieshypocoristicallymonopolisticallynonpsychiatristsindiscernibilityarchaeoastronomyhypophysectomiesthyrocalcitoninsmonosynapticallypathophysiologic
...View all with 16 letters...
Phrases (214)
strictly speakingchristian huygenscygnus buccinatorgenus crotaphytusbluegrass countryfamily locustidaeacross the countrycock-and-bull storymechanical systemschool dictionary
...View all with 16 letters...
Words (97)
counterinsurgencysuperconductivityconstitutionalitymaterialisticallycardiorespiratoryelectrostaticallycontemporaneouslyinconsequentiallypsycholinguisticspsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeuticradioisotopicallyparapsychologistsparasitologicallyspectrophotometryspectroscopicallyrationalisticallythrombocytopeniasmonosyllabicitiespaternalisticallyhypophysectomizeshypophysectomisedhypophysectomizedcryopreservationscryptocrystallineidiosyncraticallyencephalomyelitiscrystallographerscrystallographies
...View all with 17 letters...
Phrases (229)
balaena mysticetussubphylum craniatatheological systemantipsychotic drugcylinder separatorcalycanthus familycapital of malaysiainvestment companymutually exclusivesanitary condition
...View all with 17 letters...
Words (60)
characteristicallyinconsequentialitypsychopathologicalpolyesterificationspectrofluorometryspectroheliographypsychotherapeuticshypophysectomizingpathophysiologicalcylindrical-stemmedperchloroethylenespostpsychoanalyticunconstitutionallystereospecificallystoichiometricallyrecrystallizationshypercholesteremiasaccharomycetaceaemagnetostrictivelydehydrochlorinatestrichloroethylenesorthopsychiatristsgranulocytopoiesesspectrographicallygranulocytopoiesisaerothermodynamicsneuropsychiatristselectromyographiesneuropsychologistshistocompatibilityelectrophysiologicincommensurabilitymicrocrystallinitypropagandisticallyrhabdomyosarcomata
...View all with 18 letters...
Phrases (251)
lachrymal secretiondivision cynodontiagenus styracosauruscolumbia universitymary wollstonecraftclass schizomycetessuperiority complexantipsychotic agentgenus chamaecytisushypostasis of christ
...View all with 18 letters...
Words (39)
polyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomiescrosslinguisticallynonrelativisticallyunconstitutionalityconceptualisticallycytopathogenicitiesimmunocytochemistryindividualisticallyphenomenalisticallyphosphatidylcholineelectrodynamometerschromoblastomycosiscontradistinctivelycross-linguisticallyimpressionisticallymethylcholanthreneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshistopathologicallyhistoriographicallydihydrostreptomycinparasympathomimeticsymptomatologicallydiethylcarbamazinessociolinguisticallyhyperconcentrationspsychophysiologistshypoadrenocorticismpsychotomimetically
...View all with 19 letters...
Phrases (200)
acetylsalicylic acidscandinavian countryseventeen-year locusthydrastis canadensisgiles lytton stracheyfamily dasyproctidaejacques yves cousteaudivision schizophytagenus cryptobranchuscapital of kyrgyzstan
...View all with 19 letters...
Words (34)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallylipochondrodystrophycrystallographicallyhyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallymagnetohydrodynamicshistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditispseudoparenchymatoushydrochlorothiazidespsychopathologicallypsychopharmacologistsyncategorematicallyhypercholesterolemichypercoagulabilitiesheterobasidiomycetesplethysmographicallyexistentialisticallyPhrases (190)
yellow-shafted flickerwyethia amplexicaulisorder mycelia steriliaorder myxobacterialesoryctolagus cuniculusdivision tracheophytabalance sheet analysisdianthus caryophyllussuricata tetradactylaeucalyptus calophylla
...View all with 20 letters...
Words (8)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesacetylcholinesteraseshypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (139)
electrolytic condenserhelichrysum bracteatumeucalyptus fraxinoidescapital of pennsylvaniaginglymostoma cirratumparty to the transactioncucurbita argyrospermaarctostaphylos uva-ursispectroscopic analysissamuel taylor coleridge
...View all with 21 letters...
Words (6)
spectrophotometricallyintercomprehensibilitycarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (137)
lycopersicon esculentumhaliaeetus leucorhyphusaccessory before the factloyalist volunteer forcerhythm and blues musiciancrescent city connectionmale reproductive systemfamily branchiostomidaeatmospheric electricitycombined dna index system
...View all with 22 letters...
Words (1)
carboxymethylcellulosesPhrases (106)
calycanthus occidentalisthryothorus ludovicianuscanyonlands national parkdorothy rothschild parkersciadopitys verticillatatricyclic antidepressantmcguffey eclectic readerssearch and destroy missionornithorhynchus anatinuschrysanthemum parthenium
...View all with 23 letters...
Words (2)
laryngotracheobronchitisschizosaccharomycetaceaePhrases (77)
carnegie mellon universitysubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying crosstechnology administrationhypersensitivity reaction
...View all with 24 letters...
Phrases (73)
igor fyodorovich stravinskymary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatusmodest petrovich mussorgskypolystichum acrostichoidesmelanerpes erythrocephalusreligious society of friendscaulophyllum thalictroidesmichelson-morley experiment
...View all with 25 letters...
Phrases (48)
hunting and gathering societysecretary of veterans affairsemployee stock ownership plancharles maurice de talleyrandsubdivision basidiomycotinasubdivision coniferophytinasubdivision deuteromycotinasubdivision mastigomycotinabureau of diplomatic securitybenign prostatic hyperplasia
...View all with 26 letters...
Phrases (39)
nikita sergeyevich khrushchevcommissioned military officernuclear regulatory commissionsecretary of commerce and labortricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (36)
triphosphopyridine nucleotidemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Phrases (21)
acrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemhydrangea macrophylla hortensisultrasonic pulse velocity testerfrancisco jose de goya y lucientesarrhenius theory of dissociation
...View all with 29 letters...
Phrases (23)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndromecalymmatobacterium granulomatis
...View all with 30 letters...
Phrases (12)
digital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositiondefense information systems agency
...View all with 31 letters...
Phrases (17)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophy
...View all with 32 letters...
Phrases (12)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacus
...View all with 33 letters...
Phrases (8)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
secretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (11)
university of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdefense advanced research projects agencyus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
