Words Containing: C,I,I,L,Y
(In Any Order)
There are 2,111 words,
2,098 phrases and
0 abbr's with
C,I,I,L,Y in.
Best Scoring Words With: C,I,I,L,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| juicily | 7 | 19 | verb, adverbv, adv | |||||
Valid word for Scrabble US
| ||||||||
| civilly | 7 | 15 | adverbadv | |||||
adverb • in a civil manner | ||||||||
| itchily | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| ickily | 6 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| vinylic | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| pricily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| spicily | 7 | 14 | adverbadv | |||||
adverb • with strong spices; in a spicy manner | ||||||||
| sibylic | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| idyllic | 7 | 13 | adjectiveadj | |||||
adjective satellite • excellent and delightful in all respects • suggestive of an idyll; charmingly simple and serene | ||||||||
| dicliny | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
icilyWords (39)
facilityfelicityluciditycivilitylyricistcyrilliclyricismdocilitysibyllictrickilychirpilylyriciselyricizebitchilycrispilystylitichelicityimpolicyvinciblybicyclicdialyticsilicifypitchilymyelinicchillilystickilysicklilyviscidlydicyclicpyeliticbiolyticcalidityhylicismhylicistchylific
...View all with 8 letters...
Phrases (2)
city linecivil dayWords (76)
publicityviciouslymilitancybicyclingduplicitytricyclicstylisticbicyclistpoliticlysalicylicillicitlyacclivitylubricityplacidityisocyclicgracilityductilitycyclicitydeclivitytactilityirasciblychidinglyscrimpilyfinicallylyophilicsibilancylyricisedlyricistslyricizesfictivelyuncivillysocialitycivicallytwitchilyciliately
...View all with 9 letters...
Phrases (3)
civil yeareye cliniccity limitWords (161)
incrediblyofficiallydifficultysimplicityironicallyspecialitycapabilitydistinctlyindirectlyclinicallycriticallycomplicityexplicitlypiccadillycriminallylegitimacyelasticityimplicitlyclarifyingdecisivelyilliteracybiblicallymusicalityproclivitychildishlysyphiliticbrilliancysuicidallyimbecilityresiliencypsilocybinanxiolyticiconicallyunicyclistinvincibly
...View all with 10 letters...
Phrases (3)
city limitssilver citysaint cyrilWords (230)
electricitypoliticallycredibilityfinanciallyefficientlymasculinityvicariouslycriminologyprincipallycriminalityexclusivitydeliciouslymaliciouslyphysicalitypeculiaritycylindricalculpabilityintricatelyjudiciouslyincredulitybiophysicalofficiouslycertifiablyempiricallyclassifyingcognitivelysociabilityidenticallydifficultlyselectivitycircularitybricklayingsickeninglypictoriallyidiotically
...View all with 11 letters...
Phrases (19)
laying claimbody politicacrylic acidceltic deitycity of lightprimary coilbicycle clipbirch familyafrican lilyiliac artery
...View all with 11 letters...
Words (304)
specificallyincreasinglyindistinctlyincidentallydisciplinarysufficientlyhypocriticalmunicipalityhistoricallyridiculouslyunofficiallyartificiallysuspiciouslybiologicallyperiodicallytechnicalitytriglycerideinexplicablyartisticallyconvincinglyelectrifyinghieroglyphicterrificallyinextricablyconvivialitycongenialityproficientlycollectivitypracticalitymicrobiologycoincidentlyprincipalityexcitabilityincorrigiblybeneficially
...View all with 12 letters...
Phrases (47)
visual acuitylickety splithockey clinicacrylic fiberacrylic paintacrylic resinislamic unityadenylic acidbodily cavitywild hyacinth
...View all with 12 letters...
Words (363)
significantlyinstinctivelystatisticallyhieroglyphicsphysiologicalrealisticallycompatibilitymagnificentlynitroglycerinideologicallysuperficiallyfunctionalityimperceptiblyinvincibilitycholecystitisparticularityaccessibilitycompetitivelyunflinchinglytheatricalityapplicabilitypatrioticallyinefficientlydistinctivelyartificialityintrinsicallyichthyologistdiametricallyindescribablycrystallizingacceptabilityincontinentlyfascinatinglyaxiomaticallyinjudiciously
...View all with 13 letters...
Phrases (52)
family picidaebilly mitchellcalifornia yewinclusion bodysocial anxietypublic utilitycranial cavitytribal societyfamily arcidaeorbital cavity
...View all with 13 letters...
Words (325)
scientificallycoincidentallyaccountabilityrespectabilityconfidentiallynitroglycerineexcruciatinglypredictabilityclitoridectomysusceptibilitysatisfactorilylinguisticallysociologicallydiplomaticallyinconvenientlyinsufficientlyoptimisticallyconvertibilityunconvincinglyappreciativelysuperficialityinconsiderablysimplisticallyidealisticallyaltruisticallyimpracticalitybiographicallydiagnosticallyreconciliatorydirectionalityinscrutabilitybioelectricityirrevocabilityconceivabilitycombustibility
...View all with 14 letters...
Phrases (102)
family apiaceaecapital of italycapital of libyapolymeric amidecarya laciniosaemily dickinsonmilitary actioncapital of syriasocial activityaxillary cavity
...View all with 14 letters...
Words (247)
confidentialityunconditionallyphysiologicallyphilosophicallyconscientiouslysynergisticallyinaccessibilityincompatibilitycrystallizationintellectualitypsychobiologistmicroscopicallyinconspicuouslysuccinylcholinerecrystallizinglackadaisicallyintrospectivelyunacceptabilitycommunicabilitylogarithmicallyseismologicallyinconsideratelyeuphemisticallyritualisticallypessimisticallypsychiatricallyconventionalityvoyeuristicallykinestheticallythyrocalcitoninapproachabilitycontemptibilityunchangeabilitysanctimoniouslyreproducibility
...View all with 15 letters...
Phrases (152)
auditory ossicledialysis machinepsychotic belieffamily astacidaepipeline companyrailway junctioninsurance policyequinoctial yearpolitical entityparalytic abasia
...View all with 15 letters...
Words (135)
enthusiasticallyindiscriminatelyconstitutionallyincomprehensiblyunpredictabilityimperceptibilityuncompromisinglyjournalisticallycircumstantiallysurrealisticallypsychobiologicalincontrovertiblyinconceivabilityincorruptibilitydiscriminatorilyparadigmaticallycolorimetricallyjurisdictionallyantistrophicallyradiographicallytrinitroglycerincommensurabilitynoncompetitivelythermoplasticityimperfectibilityunconditionalitypositivisticallyhypocoristicallymonopolisticallyindiscernibilitythyrocalcitoninspathophysiologicmonotheisticallyarchiepiscopallycriminologically
...View all with 16 letters...
Phrases (175)
strictly speakingfamily cyprinidaewilliam wycherleycardiac glycosidechemical analysisfamily locustidaecarya illinoensiscarya illinoinsisofficial emissaryofficial immunity
...View all with 16 letters...
Words (84)
unconventionalitybacteriologicallyconstitutionalitymaterialisticallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsycholinguisticsmultidisciplinaryprobabilisticallyinterdisciplinaryradiobiologicallyisoelectronicallycercidiphyllaceaeunexchangeabilitykaleidoscopicallyradioisotopicallyparasitologicallyrationalisticallymonosyllabicitiespaternalisticallyarchitectonicallyferrimagneticallylexicographicallyidiosyncraticallyencephalomyelitisillusionisticallydisrespectabilitytranscriptionallylymphangiographictransdisciplinaryrecrystallizationconfigurationallyimmunogenetically
...View all with 17 letters...
Phrases (196)
lycopodium alpinumcylindrical liningcommercial briberyfamily trochilidaecaesarian deliverycapital of malaysiafamily erinaceidaefamily bucerotidaeclimbing hydrangeareligious ceremony
...View all with 17 letters...
Words (49)
characteristicallyinconsequentialityhypercoagulabilityinterchangeabilitysociopsychologicalpolyesterificationpolyribonucleotidemultifunctionalitypathophysiologicalcylindrical-stemmedlipopolysaccharideunconstitutionallystereospecificallyimmunocytochemicalstoichiometricallyautobiographicallyrecrystallizationscounterintuitivelymagnetostrictivelysubmicroscopicallyoscillographicallygranulocytopoiesishistocompatibilityelectrophysiologicincommensurabilitymicrocrystallinitypropagandisticallyhistophysiologicalhydroelectricitiespsychobiographicalsedimentologicallyoveroptimisticallysemiconservativelyintraventricularlyphysiopathological
...View all with 18 letters...
Phrases (205)
podilymbus podicepscolumbia universityfamily trichechidaesuperiority complexcommercial activityfamily desmidiaceaefulminating mercuryvictory celebrationfamily magnoliaceaephoenix dactylifera
...View all with 18 letters...
Words (42)
hydrochlorothiazidepsychophysiologicalcinematographicallypolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilitycrosslinguisticallynonrelativisticallylipopolysaccharidesunconstitutionalityconceptualisticallyindividualisticallyphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineinterconvertibilitycontradistinctivelyinterferometricallycross-linguisticallyimpressionisticallyelectrophysiologieselectrophysiologistdeoxyribonucleotideincomprehensibilitymicroelectronicallycortico-hypothalamicencephalomyelitideshistopathologicallyhistoriographicallyincontrovertibilitydiethylcarbamazinescounterinflationary
...View all with 19 letters...
Phrases (213)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaemillimeter of mercuryalpine type of glacierfamily dasyproctidaefamily polypodiaceaesalicylate poisoningsymphytum officinalecost-benefit analysis
...View all with 19 letters...
Words (21)
uncharacteristicallyoverenthusiasticallyimmunocytochemicallymagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhistoincompatibilityiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesencephalomyocarditishydrochlorothiazidesmicrophotometricallyhypercoagulabilitiesexistentialisticallyPhrases (215)
wyethia amplexicaulisorder mycelia steriliafamily trachipteridaeclyde william tombaughfamily dermochelyidaemechanically skillfulfamily pseudococcidaeclassification systemclassifying adjectiveluscinia megarhynchos
...View all with 20 letters...
Words (7)
hypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisphotolithographicallyantiferromagneticallypsychophysiologicallyclinicopathologicallyPhrases (142)
icelandic monetary unitdesoxyribonucleic acideucalyptus fraxinoidescynoglossum officinalecapital of pennsylvaniaginglymostoma cirratumcolombian monetary unitspectroscopic analysisprocaine hydrochloridearticulatio synovialis
...View all with 21 letters...
Words (4)
intercomprehensibilityotorhinolaryngologicalelectrophysiologicallyencephalomyocarditisesPhrases (130)
family dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianbrachycome iberidifoliafamily branchiostomidaeatmospheric electricityedna saint vincent millayfamily mycobacteriaceaedisplaying incompetencefederal security service
...View all with 22 letters...
Words (3)
laryngotracheobronchitiselectrocardiographicallymicroelectrophoreticallyPhrases (61)
carnegie mellon universityunidentified flying objectprivately held corporationbrassica oleracea botrytisdistinguished flying crossapocynum androsaemifoliumfluoxetine hydrocholoridetechnology administrationhydroxyzine hydrochloridechrysosplenium americanum
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (58)
francis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencypolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidespyotr alexeyevich kropotkinmichelson-morley experimentconstant of proportionalitylepidocybium flavobrunneum
...View all with 25 letters...
Phrases (38)
assyrian neo-aramaic languagebureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansconjunctival layer of eyelidsuniformly decelerated motioncircumflex artery of the thighcalycophyllum candidissimumhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (39)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (30)
ephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskymaster of arts in library sciencedissident irish republican armyrevolutionary communist league
...View all with 28 letters...
Phrases (21)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systeminternational olympic committeeultrasonic pulse velocity testernational intelligence communityfrancisco jose de goya y lucientestheory of punctuated equilibriumfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (21)
alexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiaecalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (11)
digital communications technologyrevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityvladimir vladimirovich mayakovskihuygens' principle of superposition
...View all with 31 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (11)
lycopersicon esculentum cerasiformenondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerhighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economysubacute inclusion body encephalitisunited states intelligence community
...View all with 33 letters...
Phrases (8)
university of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccineu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
