Words Containing: A,S,Y,L
(In Any Order)
There are 5,993 words,
3,935 phrases and
0 abbr's with
A,S,Y,L in.
Best Scoring Words With: A,S,Y,L
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
syzygal | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
skywalk | 7 | 21 | nounn | |||||
noun • an elevated walkway between buildings (usually enclosed) | ||||||||
sizably | 7 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
squally | 7 | 19 | adverb, adjectiveadv, adj | |||||
adjective satellite • characterized by short periods of noisy commotion • characterized by brief periods of violent wind or rain | ||||||||
calyxes | 7 | 19 | nounn | |||||
noun • (botany) the whorl of sepals of a flower collectively forming the outer floral envelope or layer of the perianth enclosing and supporting the developing bud; usually green | ||||||||
flyways | 7 | 19 | nounn | |||||
noun • the geographic route along which birds customarily migrate | ||||||||
squatly | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
bashlyk | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
skylark | 7 | 18 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (223)
usuallycrystalstanleydisplaylindsayslaveryanalystsharplyghastlyfalselyanalysecalypsoharshlyparsleyslayingsaintlysparklybeastlyeyelashhastilyyisraelstatelyfalsityelysianshapelyfalsifysmartlyabysmalpaisleyskylarkshakilysplashyslipwayskywalkstarkly
...View all with 7 letters...
Phrases (6)
sea lilylast dayyolk sacugly asssand flyeasy layWords (459)
physicalanalysisassemblysexuallyjealousysolitarymysticalmalaysiasociallysyllablecasualtycasuallysyllabussteadilyscarcelydialysisvisuallyinsanelyladyshipplatypusdisloyalladyfishcatalystclassifyfamouslyyugoslavsquarelyanalyseddistallystealthyabsurdlysavagelyspyglasssuitablydyslexia
...View all with 8 letters...
Phrases (20)
small frylord's dayalms traysalt awayplay listyak's milksea hollynavy seallang syneslip away
...View all with 8 letters...
Words (655)
basicallyspeciallyinstantlyspecialtystrangelysexualityyggdrasilstabilityhairstyleblasphemyhimalayasparalysisdisplayedunusuallyastrologysimilarlyparalysedanxiouslymiserablymusicallydaylightscataclysmaimlesslymalaysianplayhousemassivelyscholarlyanalysingsalisburyswordplaylazybonesdistantlyearnestlydastardlypolynesia
...View all with 9 letters...
Phrases (53)
salary cutlake nyasahair stylelammas daymealy sagegenus hylapaul heyseearly daysstay relaygrass poly
...View all with 9 letters...
Words (735)
absolutelyespeciallypersonallyconstantlyphysicallyscreenplayhystericalseparatelysolidaritydisneylandapocalypsedisabilitypresumablyyugoslaviareasonablyspecialitysimilarityhydraulicssensualityschoolyardsleepyheadpleasantlymistakenlygraciouslyhandsomelystealthilysurgicallycarelesslyeucalyptuscautiouslycosmicallyfabulouslydisloyaltyeyeglassesdisqualify
...View all with 10 letters...
Phrases (85)
field pansylead astrayheavy swellspanish flyeaster lilyst. polycarpmaple syrupbasil thymelawyer bushshadow play
...View all with 10 letters...
Words (784)
personalitynecessarilyessentiallydesperatelyhospitalitydangerouslyspirituallysymmetricalanonymouslydrasticallyinstabilitymasculinitycataclysmicunanimouslyshamelesslyuniversallysingularityincessantlyassemblymanvicariouslyfashionablypyroclasticcrystallinelaparoscopyhorseplayermarvelouslyunspeakablyceaselesslyclassicallyconsultancyyugoslavianplayfulnesshairstylistmaliciouslyjustifiably
...View all with 11 letters...
Phrases (126)
genus lycosagrass familylaying wastelouis leakeymary shelleyglossy snakelaugh softlyspecial jurybicycle seatbald cypress
...View all with 11 letters...
Words (811)
specificallyoccasionallyincreasinglypennsylvaniadisciplinarypassionatelyspiritualityconsiderablymiraculouslyhistoricallyaggressivelymetaphysicalhystericallytransylvaniastructurallysymbolicallyartisticallyclytemnestracourageouslycrystallizedhypothalamusasymmetricaldomesticallydesirabilitymonosyllabicpolysyllabicharmoniouslypsychobabbleoutrageouslyconstabularyautonomouslybreathlesslyprecariouslyforensicallyunreasonably
...View all with 12 letters...
Phrases (190)
visual acuityscantily cladcalvary crossshaking palsysquirrel awayphantasy lifeacrylic resincost analysistreasury billanas clypeata
...View all with 12 letters...
Words (716)
psychologicalunnecessarilyhomosexualitysignificantlystatisticallyspontaneouslydysfunctionalpsychoanalystfantasticallyphysiologicalsubstantiallygynaecologistrealisticallystrategicallyspectacularlysarcasticallyastonishinglysupplementaryeverlastinglystereotypicalpainstakinglysuperficiallyaestheticallypsychoanalyzedissimilarityintravenouslysensationallysymmetricallyaccessibilityprovisionallydimensionallyhydrocephalussentimentallydisparaginglystaphylococci
...View all with 13 letters...
Phrases (240)
aleatory musicel iskandriyahsecond balconyin a similar waycustody battlemyrsine familycooley's anemiaacrylate resingenus cyclamenfactor analyse
...View all with 13 letters...
Words (581)
simultaneouslyprofessionallyscientificallypsychoanalysissystematicallyunderstandablysentimentalityrespectabilitysustainabilityunquestionablyconservativelyparapsychologypsychoanalyticsubcutaneouslysupernaturallysatisfactorilyembarrassinglylinguisticallymetaphysicallysociologicallyscholasticallydimensionalitystaphylococcusoptimisticallyastronomicallysuperficialityphosphorylatedinconsiderablysimplisticallyidealisticallyaltruisticallyasynchronouslyplethysmographostentatiouslydiagnostically
...View all with 14 letters...
Phrases (279)
battle of nasebymoonseed familysabbatical yearclass scyphozoaadmiralty brassmaxillary sinusvisual propertyblackberry bushskeletal systembusman's holiday
...View all with 14 letters...
Words (426)
psychologicallyinstantaneouslyanaesthesiologyphysiologicallyphilosophicallyheterosexualitysynergisticallyinaccessibilitycrystallizationsuppositionallymicroscopicallydisappointinglyinfinitesimallyinstrumentalitycontroversiallycytomegaloviruscompassionatelyrecrystallizinglackadaisicallypostoperativelypolyunsaturateddemonstrativelyinspirationallygastronomicallycrystallographyseismologicallypsychopathologysympatheticallydispassionatelyinconsideratelyeuphemisticallyritualisticallypessimisticallypsychiatricallyvoyeuristically
...View all with 15 letters...
Phrases (323)
syringa vulgarisauditory ossicleclass pelecypodaalimentary pasteasamiya languagedialysis machinegenus sylvilagusgenus bombycillaadmiralty islandlycosa tarentula
...View all with 15 letters...
Words (178)
enthusiasticallyindiscriminatelyconstitutionallycatastrophicallypsychoanalyticalquintessentiallyjournalisticallycircumstantiallymonosyllabicallyerythroblastosisextemporaneouslythermostaticallysurrealisticallypsychobiologicalunprofessionallyparapsychologistconversationallydiscriminatorilyhypersalivationsinextinguishablyjurisdictionallyantistrophicallyspondylarthritiscommensurabilityotolaryngologisthypersexualitiesinexhaustibilitythermoplasticityunostentatiouslyhyperstimulatingparaphrasticallyhyperstimulationadministrativelyparapsychologiespolysynaptically
...View all with 16 letters...
Phrases (357)
in a beastly mannerstrictly speakingcardiac glycosidebluegrass countrychemical analysishypophyseal stalkpodocarpus familyfamily locustidaecarya illinoensiscarya illinoinsis
...View all with 16 letters...
Words (103)
straightforwardlyconstitutionalitymaterialisticallyelectrostaticallycontemporaneouslyinconsequentiallysocioeconomicallymultidisciplinaryprobabilisticallyinterdisciplinaryself-contradictoryisoelectronicallyparaformaldehydeskaleidoscopicallyradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallyrationalisticallyhypnotizabilitiesmonosyllabicitiespaternalisticallypathophysiologiesunderstandabilitycryptocrystallineidiosyncraticallyencephalomyelitiscrystallographerscrystallographiesillusionisticallypostrevolutionaryuntranslatability
...View all with 17 letters...
Phrases (367)
salvia leucophyllabalaena mysticetuspearly everlastingclass rhodophyceaefamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusmalaysian languagetheological system
...View all with 17 letters...
Words (74)
characteristicallydisproportionatelyinconsequentialitypsychopharmacologypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalpolyesterificationpolymorphonuclearsspectroheliographypathophysiologicalpentylenetetrazolscylindrical-stemmedlaryngopharyngitislipopolysaccharidepostpsychoanalyticunconstitutionallylymphangiographiesstereospecificallytransformationallystoichiometricallyrecrystallizationsdistinguishabilitymucopolysaccharidehypercholesteremiamagnetostrictivelysubmicroscopicallydehydrochlorinasesdehydrochlorinatesglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesis
...View all with 18 letters...
Phrases (344)
bombycilla garrulusfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologynavigational systemcolumbia universitymary wollstonecraftclass schizomycetesfamily asparagaceae
...View all with 18 letters...
Words (41)
psychophysiologicalpolyesterificationsextralinguisticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalityconceptualisticallyindividualisticallyphenomenalisticallyphosphatidylcholineelectrodynamometersphosphoenolpyruvatechromoblastomycosiscontradistinctivelythird-dimensionalityhysterosalpingogramcross-linguisticallythree-dimensionalityimpressionisticallymethylcholanthrenesencephalomyelitideshistopathologicallyhistoriographicallypsychopharmacologicsymptomatologicallydiethylcarbamazinesphytohemagglutininssociolinguisticallytetramethyldiarsinedimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamines
...View all with 19 letters...
Phrases (314)
acetylsalicylic acidfamily cynoglossidaeseventeen-year locustclass polyplacophoragiles lytton stracheyfamily lepisosteidaefamily dasyproctidaecapital of kyrgyzstancalycanthus floridussalicylate poisoning
...View all with 19 letters...
Words (35)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyradioimmunoassayablecrystallographicallyindistinguishabilitylymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhistoincompatibilityultramicroscopicallyelectrophysiologicalmicrocrystallinitiesencephalomyocarditisphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiespalatopharyngoplastydimethylnitrosaminesplethysmographicallyexistentialisticallyPhrases (284)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesbalaenoptera physalusoryctolagus cuniculusbalance sheet analysisbyelorussian language
...View all with 20 letters...
Words (15)
psychopharmacologicalotorhinolaryngologiststereomicroscopicallymucopolysaccharidosisalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologiesphotophosphorylationsintersubstitutabilityhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (197)
nikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoidescynoglossum officinaleisle royal national parkcapital of pennsylvania
...View all with 21 letters...
Words (6)
spectrophotometricallyphosphoglyceraldehydesotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (167)
haliaeetus leucorhyphusaleksandr i. solzhenitsynloyalist volunteer forcesubfamily bassariscidaesodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesmale reproductive systemfamily branchiostomidaeatmospheric electricity
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (134)
family threskiornithidaeposterior pituitary glandyellowstone national parkcalycanthus occidentalisthryothorus ludovicianuscanyonlands national parkbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillata
...View all with 23 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (88)
carnegie mellon universitylouis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumexistentialist philosophyalfred edward woodley masontechnology administration
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (73)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddington
...View all with 25 letters...
Phrases (55)
brassica oleracea gongylodessubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandbureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizans
...View all with 26 letters...
Phrases (46)
business environment analysisaleksandr sergeyevich pushkinaugustus welby northmore pugincommissioned military officernuclear regulatory commissionsecretary of commerce and labortricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (37)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensisfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Phrases (24)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testerfrancisco jose de goya y lucientes
...View all with 29 letters...
Phrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentscalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Phrases (10)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologyrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyermarine corps intelligence activityvladimir vladimirovich mayakovskimary godwin wollstonecraft shelleyPhrases (16)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (11)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicessubacute inclusion body encephalitisunited states intelligence community
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicenational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay