Words Containing: A,R,P,Y
(In Any Order)
There are 4,355 words,
3,115 phrases and
0 abbr's with
A,R,P,Y in.
Best Scoring Words With: A,R,P,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| pharynx | 7 | 22 | nounn | |||||
noun • the passage to the stomach and lungs; in the front part of the neck below the chin and above the collarbone | ||||||||
| parkway | 7 | 19 | nounn | |||||
noun • a wide scenic road planted with trees | ||||||||
| jaspery | 7 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| apteryx | 7 | 19 | nounn | |||||
noun • nocturnal flightless bird of New Zealand having a long neck and stout legs; only surviving representative of the order Apterygiformes | ||||||||
| pyrexia | 7 | 19 | nounn | |||||
noun • a rise in the temperature of the body; frequently a symptom of infection | ||||||||
| japery | 6 | 18 | nounn | |||||
noun • acting like a clown or buffoon | ||||||||
| whipray | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
| privacy | 7 | 17 | nounn | |||||
noun • the quality of being secluded from the presence or view of others • the condition of being concealed or hidden | ||||||||
| preachy | 7 | 17 | adjectiveadj | |||||
adjective satellite • inclined to or marked by tedious moralization | ||||||||
| eparchy | 7 | 17 | nounn | |||||
noun • a province in ancient Greece • a diocese of the Eastern Orthodox Church | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
prayWords (114)
therapyprivacyprimarypyramidrapidlypayrollsharplyportrayparsleysparklyatrophypapyrusparkwayscrappypreachyreapplytopiarypeccarycyprianairplaypalmyraplenaryspywarelampreyphrygiadraperysprayerflytrapprimacyoverpaypicardypharynxrespraypalfreyeparchy
...View all with 7 letters...
Phrases (3)
pay dirtpay rateper yearWords (201)
probablypharmacypartyingjeopardyforeplaysprayingabruptlyweaponryshipyardtaxpayertapestryparaguayparalyzepolaritypasserbyrhapsodypaperboyplayroomwordplayplaygirlparalyseunderpayflypaperpyorrheacapybararapiditysparselyoverplayphrygianpedantryparoxysmparleyedparryingupwardlyempyrean
...View all with 8 letters...
Phrases (33)
body parthard copycd playerglory peatea partypony cartdry platerope yardrope yarnsea spray
...View all with 8 letters...
Words (378)
temporarypregnancyparalyzedprivatelygeographyraspberryprimarilybiographypartiallypurgatoryparalysisexemplaryplanetaryportrayedparalysedpolygraphpulmonarypaternitysupremacyarchetypedepravityrepaymentpredatoryprofanitycarpentryportrayalswordplaypituitaryhairsprayparalytichorseplaypyramidalporphyriapageantrydisparity
...View all with 9 letters...
Phrases (46)
rate of payprayer matprayer rugheavy sparparty bosskeep relayfine spraywork partyarmy corpswoody pear
...View all with 9 letters...
Words (533)
apparentlypersonallyconspiracyscreenplayplaygroundrepeatedlyseparatelybankruptcypreferablypopularitypresumablyhyperspacepsychiatryexpresswayskyscrapercyberspaceplaywrightpythagoraspyromaniacballplayertopographynarcolepsyportrayingdispensarytypographyarchetypalproximallyprofitablycryptogrampatriarchyapothecaryoverpayingphylloxeratryptophantomography
...View all with 10 letters...
Phrases (77)
private eyegolf playeremery paperprayer bookparis daisypastry cookrole playersugar syrupkey patternalkyl group
...View all with 10 letters...
Words (656)
personalitypracticallyphotographyimportantlydesperatelypsychiatrictemporarilypreliminarypermanentlyprobabilitycalligraphyrespiratoryspirituallyprematurelyhypothermiahypermarkethyperactivediscrepancypterodactylproprietaryperpetuallyexplanatoryiconographypyroclasticprincipallylaparoscopyhorseplayerexploratorypreparatorybathyspheresympathizerpredictablyplaywritingsphericallypleasurably
...View all with 11 letters...
Phrases (116)
humphry davygypsum boardplaying areaspecial juryrunning playproperty taxbald cypresspiano playerpolicy makerparaguay tea
...View all with 11 letters...
Words (580)
particularlypsychiatristcontemporarychemotherapydisciplinarypenitentiaryhypocriticalspiritualitychoreographyanthropologyparamilitaryperiodicallytransparencyperipherallyaromatherapypresbyterianprobationarytriumphantlyastrophysicsphilanthropypharmacologypraiseworthyprecariouslyhypnotherapyimpartialityhypochondriaprophylacticoceanographyhyperaciditypejorativelycompensatorycryptographypracticalityradiotherapypolyurethane
...View all with 12 letters...
Phrases (148)
chlorophyll astaying powerbarbary sheepacrylic paintgenus apteryxdramatic playreal propertytennis playerboris spasskypetit larceny
...View all with 12 letters...
Words (551)
approximatelyautobiographyappropriatelycomplimentaryparliamentarypsychotherapyprecautionarypredominantlyhypochondriacimprobabilityphysiotherapyspectacularlyparadoxicallycomparativelycomplementarysupplementarystereotypicalsuperficiallyexpeditionaryhyperactivitypreliminarilyparticularityprofitabilityprovisionallyprovocativelyarchaeopteryxpredominatelyhydrocephalushypercalcemiaparabolicallydisparaginglycryptographerpatrioticallyprostatectomypolycarbonate
...View all with 13 letters...
Phrases (197)
myrobalan plumadvocacy groupspiny anteaterprivate treatybarbary piratetaste propertygenus bradypuspraying mantidbattle of ypresprime quantity
...View all with 13 letters...
Words (436)
professionallycinematographymetaphoricallyrespectabilitygeographicallyinterplanetarycardiomyopathypancreatectomyastrophysicistelectrotherapyhyperventilateproportionallyparapsychologypredictabilitysupernaturallyexperimentallyphotogrammetryappreciativelysuperficialityphosphorylatedpolymerizationhydropneumaticprovidentiallyorthopedicallyplethysmographimpracticalitydepartmentallyarchetypicallybiographicallyneuropathologychromatographyhydrotherapistpreferentiallydisapprovinglyhistoriography
...View all with 14 letters...
Phrases (209)
pearl mae baileypituitary dwarftubal pregnancypituitary glandnavy departmentvisual propertypolymeric amidex-ray photographpharaoh of egyptprimary feather
...View all with 14 letters...
Words (359)
psychotherapistinappropriatelyphysiotherapistparentheticallyplenipotentiarymicroscopicallyproportionatelycardiopulmonarytherapeuticallyuncomplimentaryencephalographypostoperativelyunparliamentaryproportionalitypolyunsaturatedinspirationallycrystallographyhypochondriacalgynandromorphicdemographicallyneuropsychiatrypsychiatricallytemperamentallydiphenhydramineperpendicularlyultrasonographyimperishabilityapproachabilitychemoautotrophycomplementarityimponderabilityperspicaciouslyphysiographicalpolysaccharidesastrophysicists
...View all with 15 letters...
Phrases (238)
alimentary pastemrs. humphrey wardprivate propertyfamily leporidaeorycteropus aferstonecrop familyspiny-headed wormx-ray photographyscholarly personrhythmic pattern
...View all with 15 letters...
Words (182)
pheochromocytomacatastrophicallytriphenylmethaneunpredictabilityhyperventilationelectromyographypharmaceuticallysphygmomanometerextemporaneouslythrombocytopeniaphotographicallyunprofessionallyparapsychologistneuropsychiatrichypersalivationsparadigmaticallypornographicallyheterokontophytaparaformaldehydeantistrophicallyspondylarthritisextracorporeallyparamagneticallyradiographicallymicrogametophytehypersexualitiespolyrhythmicallythermoplasticityhyperstimulatingnonparticipatoryparaphrasticallyhyperstimulationparapsychologiesparasympatheticsapocryphalnesses
...View all with 16 letters...
Phrases (253)
tympanic membranestrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitygenus crotaphytuspodocarpus familyautogenic therapyvolleyball player
...View all with 16 letters...
Words (125)
anthropologicallyparathyroidectomycardiorespiratorycontemporaneouslyphilanthropicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesphysiotherapeuticcercidiphyllaceaepolymorphonuclearparaformaldehydesradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallysphygmomanometersthrombocytopeniashypochondriacallypaternalisticallymammothermographymorphogeneticallycryopreservationslexicographicallycryptocrystallinelaryngopharyngealcrystallographerspentylenetetrazolcrystallographiespostrevolutionary
...View all with 17 letters...
Phrases (282)
mary leontyne pricedivision bryophytapearly everlastingclass rhodophyceaelycopus americanussubphylum craniataantipsychotic drugcylinder separatorprimary censorshiprepublic of hungary
...View all with 17 letters...
Words (60)
disproportionatelyhypercoagulabilitypsychopharmacologyhyperaldosteronismneuropsychologicalpolyesterificationhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpentylenetetrazolsanthropocentricitylaryngopharyngitislipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallyautobiographicallypteridospermaphytamucopolysaccharidehypercholesteremiamyeloproliferativesubmicroscopicallypheochromocytomataorthopsychiatristsoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesisrepresentationallyneuropsychiatristselectromyographiesmetallographically
...View all with 18 letters...
Phrases (280)
revolutionary groupfamily physeteridaeeriobotrya japonicafreudian psychologyposterior pituitaryread-only memory chipmetric capacity unitfamily asparagaceaemegacycle per secondhypostasis of christ
...View all with 18 letters...
Words (41)
hyperparathyroidismcinematographicallypolyesterificationshypersensitizationsparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsmucopolysaccharideslipopolysaccharidesbacteriochlorophyllpharmacodynamicallyphenylthiocarbamidechromatographicallyechoencephalographyphosphoenolpyruvateinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallyanthropocentricallyanthropomorphicallyelectroretinographycortico-hypothalamicphenylpropanolaminehistoriographicallyparasympathomimeticoverproportionatelypsychopharmacologicphytogeographicallyhyperconcentrationshypoadrenocorticismhyperemotionalitiesdimethyltryptamineshyperexcitabilities
...View all with 19 letters...
Phrases (260)
water-plantain familyfamily cyclopteridaeclass polyplacophoraalpine type of glacierphytolacca americanafamily dasyproctidaegenus cryptobranchusgenus symphoricarposcapital of kyrgyzstanavogadro's hypothesis
...View all with 19 letters...
Words (29)
hypercholesterolemiaparathyroidectomizedcrystallographicallyhyperadrenocorticismlymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyultramicroscopicallyelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpseudoparenchymatouspsychopharmacologiesmicrophotometricallypsychopharmacologisthypercoagulabilitiespalatopharyngoplastyplethysmographicallyhyperparathyroidismsPhrases (213)
balaenoptera physalusfamily trachipteridaemarchantia polymorphadivision tracheophytadianthus caryophyllusfriendly relationshipjapanese monetary unitclosure by compartmenta-scan ultrasonographyamyloid protein plaque
...View all with 20 letters...
Words (11)
psychopharmacologicalstereomicroscopicallymucopolysaccharidosisphosphoglyceraldehydeelectromyographicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyPhrases (176)
extrauterine pregnancyeucalyptus fraxinoidesisle royal national parkparty to the transactioncucurbita argyrospermaarctostaphylos uva-ursispectroscopic analysisprocaine hydrochloridefamily myrmecophagidaepakistani monetary unit
...View all with 21 letters...
Words (7)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydeselectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninePhrases (131)
haliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphateathyrium thelypteroidesmale reproductive systemparaguayan monetary unitatmospheric electricitysphyrapicus varius ruber
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (112)
posterior pituitary glandyellowstone national parkparis-sorbonne universityeuropean recovery programcanyonlands national parkdorothy rothschild parkergroup pteridospermaphytasciadopitys verticillatatricyclic antidepressanthydrophyllum virginianum
...View all with 23 letters...
Words (3)
hyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyPhrases (72)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprivately held corporationprimary sex characteristicapocynum androsaemifoliumfederal republic of germanyhypersensitivity reactionchrysosplenium americanumanal retentive personality
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyuvulopalatopharyngoplastyPhrases (49)
myroxylon balsamum pereiraesymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinconstant of proportionalitylepidocybium flavobrunneumhormone-replacement therapy
...View all with 25 letters...
Phrases (50)
employee stock ownership plansubdivision coniferophytinabureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmusnonthrombocytopenic purpurasuperorder labyrinthodontia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (34)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Phrases (27)
revolutionary people's struggleephippiorhynchus senegalensiscardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitydissident irish republican armyface-amount certificate companyrevolutionary proletarian armysmall computer system interfaceimperial japanese morning glory
...View all with 28 letters...
Phrases (18)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibrium
...View all with 29 letters...
Phrases (19)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborn
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
great smoky mountains national park2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightfibrocystic disease of the pancreasmarine corps intelligence activityfrequency-response characteristicPhrases (9)
weakly interacting massive particlecercopithecus aethiops pygerythrusprimary subtractive colour for lightoculopharyngeal muscular dystrophyprogressive emphysematous necrosischrysanthemum coronarium spatiosumadult respiratory distress syndromecystic fibrosis transport regulatorjohn f. kennedy international airportPhrases (12)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economypositron emission tomography scanneridiopathic thrombocytopenic purpura
...View all with 33 letters...
Phrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdefense advanced research projects agencysixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn
