Words Containing: A,R,E,D,L,Y
(In Any Order)
There are 997 words,
1,883 phrases and
0 abbr's with
A,R,E,D,L,Y in.
Best Scoring Words With: A,R,E,D,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pedlary | 7 | 13 | nounn | |||||
noun • The trade or goods of a peddler. • Trickery | ||||||||
dryable | 7 | 13 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
already | 7 | 11 | adverbadv | |||||
adverb • prior to a specified or implied time | ||||||||
readily | 7 | 11 | adverb, adjectiveadv, adj | |||||
adverb • without much difficulty • in a punctual manner | ||||||||
layered | 7 | 11 | verb, adjectivev, adj | |||||
adjective satellite • with one layer on top of another | ||||||||
lyrated | 7 | 11 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
relayed | 7 | 11 | verbv | |||||
noun • the act of passing something along from one person or group to another • a crew of workers who relieve another crew • a fresh team to relieve weary draft animals • a race between teams; each member runs or swims part of the distance • electrical device such that current flowing through it in one circuit can switch on and off a current in a second circuit verb • pass along • control or operate by relay | ||||||||
delayer | 7 | 11 | verb, nounv, n | |||||
noun • a person who delays; to put off until later or cause to be late | ||||||||
dearly | 6 | 10 | adverb, adjectiveadv, adj | |||||
adverb • in a sincere and heartfelt manner • at a great cost • with affection | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (38)
adulterybenadrylardentlylysandermarkedlydreamilyunderlayparleyedsaddleryheraldryraggedlyreadablydefrayalforeladyalderflydapperlydelayerskaleyardvariedlydialyzerparlayedrepandlydialyserlawyeredbladderysacredlyreaderlydiablerydrearilybadgerlyreplayedchelydradielytrapanderlybylander
...View all with 8 letters...
Phrases (9)
dry cleancd playerdelta raydevil raydry plateyard lineyard salelady fernalder flyWords (81)
legendaryparalyzedparalysedroundelayfederallyassuredlyadverselychandleryunderplaymedullarycomradelyclepsydraguardedlyholidayerhydrolaseendurablydextrallydesirablydialyzersredisplayenragedlydisplayerrelaxedlyunderlayscrabbedlypolyhedrakaleyardsunreadilyparsleyedadrenallydialysersbenadrylsdietarilyrelatedlyradiately
...View all with 9 letters...
Phrases (8)
early birdearly daysdry cerealgrey alderlead storyleyden jargray alderlay readerWords (99)
repeatedlydreadfullymoderatelylumberyardcardplayerhydroplaneladyfingerdaughterlydepilatorytalleyranddeplorablyobduratelyholidayersunderplaysclepsydrasadherentlyassertedlyacrylamideperdurablyreanalyzeddepravedlyresiduallyredisplaysaccursedlydisplayersoverplayedremediallydrysaltershypodermalclepsydraehydrolasespolyhedraldayflowerspreparedlydefrayable
...View all with 10 letters...
Phrases (21)
lead astraylady killerdaily breaddaily orderharold ureyday laborerhoward pyledart playertom bradleyd'oyly carte
...View all with 10 letters...
Words (122)
desperatelydangerouslypterodactyldeliverymanpredictablyvaledictoryundesirablyparaldehydesecondarilyadvertentlydeclaratorylegendarilyeditoriallydermatologyreadabilitybarefacedlygrandioselyendearinglydaredevilryunderplayedregardfullyredundantlydenumerablyveridicallyrewardinglyswordplayerhydroplanedhydroplanespolygrapheddegradinglyunweariedlyxylographedacrylamidescardplayerstetraploidy
...View all with 11 letters...
Phrases (43)
dry cleaningmemorial daybald cypressboulder claygravy holdereudora weltyodo of lageryfive-year-oldmeadow clarygolden years
...View all with 11 letters...
Words (160)
deliberatelyconsiderablyformaldehydeperiodicallyhydrothermalcrystallizeddesirabilitydemonstrablydespairinglyfraudulentlycardiomegalyimmoderatelydeterminablyoveranalyzedlandlubberlyinordinatelycrystallisedirredeemablyabstractedlyhydrocephalyvaletudinaryholidaymakerdaredeviltryunderlaymentunderplayingirremediablyregardlesslyfarsightedlyderivativelymultilayeredrestrainedlyprudentiallyswordplayersdistractedlybigheartedly
...View all with 12 letters...
Phrases (64)
mary magdalenadmiral deweyread-only filematerial bodydevil-may-carejail deliverygrand larcenycare deliveryperiod of playthree-year-old
...View all with 12 letters...
Words (142)
inadvertentlypredominantlypredominatelyhydrocephalusadrenalectomydiametricallyindescribablydisgracefullyquadrenniallyconsideratelydeferentiallyhydrocephalicembarrassedlyunpredictablyunderhandedlycreditabilityradioactivelyhalfheartedlydiscreditablyhyaluronidasedetrimentallyspreadabilityholidaymakerssoftheartedlyhyperinflatedprejudiciallydownheartedlyaerodynamicaldeprecatinglydeprecatorilyextrudabilityadumbrativelyunderstatedlyadventurouslyrudimentarily
...View all with 13 letters...
Phrases (89)
el iskandriyahfamily laridaearnold toynbeeadmiralty miledna polymeraseedmund hillarybenzyl radicalfamily muridaefederal agencypays de la loire
...View all with 13 letters...
Words (127)
wholeheartedlyunderstandablydemocraticallypredictabilityphosphorylatedinconsiderablyintermediatelydifferentiallyprovidentiallyorthopedicallydepartmentallydirectionalitypreponderantlyheavyheartedlydeliberativelydenumerabilitylightheartedlygreatheartedlyupgradeabilityunrestrainedlyambidextrouslypreponderatelyelectrodynamicconcentratedlydemoralizinglystoutheartedlyrecrystallizedadrenergicallyindemonstrablyfaintheartedlypolyacrylamideneuroradiologyextrapyramidalbutyraldehydespresidentially
...View all with 14 letters...
Phrases (111)
family ardeidaeadmiralty metalpolymeric amidefamily turdidaefamily bramidaefamily rallidaeurinary bladderfamily scaridaealfred tennysonorder cycadales
...View all with 14 letters...
Words (105)
extraordinarilyaerodynamicallypolyunsaturateddemonstrativelydemographicallyinconsideratelyperpendicularlydemonstrabilitybidirectionallyunadulteratedlyhydromechanicalimponderabilitytenderheartedlypolysaccharidesdishearteninglyautotetraploidyhyperstimulatedhydroxylapatitesuperabundantlyradiometricallysemicylindricaldorsoventralitytetramethylleadpolyacrylamidesreduplicativelyindeterminatelyunderstandinglyhyperlipidemiashydrometallurgydecarboxylationdecarboxylatingglutaraldehydesdermatoglyphicsglyceraldehydesgrandiloquently
...View all with 15 letters...
Phrases (184)
auditory ossiclecharlotte cordaymail-order buyingby trial and errorfamily leporidaefamily artamidaefamily triglidaeradial asymmetryleveraged buyoutcomplex body part
...View all with 15 letters...
Words (26)
indiscriminatelyunpredictabilityparaformaldehydeadministrativelyperpendicularitylyginopteridalesstrongyloidiasesdecarboxylationsbiodegradabilityindescribabilityelectrohydraulichyperlipoidaemiaundemocraticallydephosphorylateddephosphorylatesdepolymerizationpalaeodendrologytranscendentallydiacetylmorphinehydroxylapatitesmelodramaticallythelypteridaceaeununderstandablytetramethylleadslepidobotryaceaeunidirectionallyPhrases (156)
italian greyhoundfamily cyprinidaecardiac glycosideexemplary damageslaundry stiffenerfamily elateridaeisland of guernseyorder polygonalesfriendly takeovergrand mal epilepsy
...View all with 16 letters...
Words (26)
thermodynamicallyinterdisciplinaryself-contradictorycercidiphyllaceaeparaformaldehydesunderstandabilitydisrespectabilitydehydrochlorinasedehydrochlorinatetridimensionalityptilonorhynchidaejurisprudentiallyturbidimetricallydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationsphotoperiodicallydeterministicallyhydroelectricallyhydrometallurgieshydrometallurgistundemonstrativelydifferentiabilityeleutherodactylusdimethylhydrazinePhrases (191)
mary mcleod bethuneclass rhodophyceaecylinder separatorfamily trochilidaecaesarian deliveryfamily droseraceaemiles dewey davis jr.family engraulidaeafrican yellowwoodsubfamily turdinae
...View all with 17 letters...
Words (18)
disproportionatelyhyperaldosteronismelectrodynamometercylindrical-stemmedlipopolysaccharidediethylmalonylureamucopolysaccharidehydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesdeoxyribonucleasesdephosphorylationshydrometallurgicalhydrometallurgistsdiethylcarbamazinedimethylhydrazinesdimethyltryptaminePhrases (169)
bombycilla cedrorunfamily physeteridaedame sybil thorndikefreudian psychologyread-only memory chipfamily trichechidaemodal auxiliary verbmegacycle per secondmarquis de lafayettearthur garfield hays
...View all with 18 letters...
Words (18)
hydrochlorothiazidemucopolysaccharideslipopolysaccharidesphenylthiocarbamidedehydrochlorinatingdehydrochlorinationelectrodynamometersinterdepartmentallycontradistinctivelythird-dimensionalitythree-dimensionalityhydroxytetracyclinehydrometeorologicaldiethylcarbamazinestetramethyldiarsinedimethylnitrosaminedimethyltryptamineselectrocardiographyPhrases (165)
family cyclopteridaefamily dasyproctidaehydrobates pelagicussubfamily perdicidaeviral delivery vectorsolidarity surchargedisability insurancefamily calliphoridaegerard manley hopkinsabo blood group system
...View all with 19 letters...
Words (7)
tetrahydrocannabinolradioimmunoassayablephenylthiocarbamidesdehydrochlorinationsencephalomyocarditishydrochlorothiazidesdimethylnitrosaminesPhrases (161)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaefamily dermochelyidaesuricata tetradactylaambystomid salamanderfriendly relationshiporder actinomycetalesamyloid protein plaque
...View all with 20 letters...
Words (4)
phosphoglyceraldehydedendrochronologicallypolyvinyl-formaldehydetetrahydrocannabinolsPhrases (100)
icelandic monetary unitaleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidaefederal security bureausyngnathus hildebrandi
...View all with 21 letters...
Words (3)
phosphoglyceraldehydesencephalomyocarditisesdihydroxyphenylalaninePhrases (91)
redevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesmale reproductive system
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (46)
subphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley masontechnology administrationfederal republic of germanyhenry wadsworth longfellowsir charles leonard woolley
...View all with 24 letters...
Phrases (39)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldpolystichum acrostichoidescaulophyllum thalictroidessir arthur stanley eddingtonlepidocybium flavobrunneumreticuloendothelial systemarab revolutionary brigadesmachine readable dictionarydiesel-hydraulic locomotive
...View all with 25 letters...
Phrases (28)
brassica oleracea gongylodescharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionhereditary cerebellar ataxiascardinius erythrophthalmus
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (32)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugbaron lloyd webber of sydmontontopical prostaglandin eyedrop
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (18)
aleksandr feodorovich kerenskyoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulosenonsteroidal anti-inflammatory
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonfrancisco jose de goya y lucientestheory of punctuated equilibriumfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (10)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidmucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusdame agatha mary clarissa christiePhrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugtheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united states
...View all with 32 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay