Words Containing: A,N,E,G,E
(In Any Order)
There are 4,472 words,
5,921 phrases and
0 abbr's with
A,N,E,G,E in.
Best Scoring Words With: A,N,E,G,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
agenize | 7 | 17 | verbv | |||||
verb • age or bleach flour with Agene (nitrogen trichloride) | ||||||||
whangee | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
avenged | 7 | 12 | verbv | |||||
adjective • for which vengeance has been taken | ||||||||
avenger | 7 | 11 | nounn | |||||
noun • someone who takes vengeance | ||||||||
endgame | 7 | 11 | nounn | |||||
noun • the final stages of an extended process of negotiation • the final stages of a chess game after most of the pieces have been removed from the board | ||||||||
engrave | 7 | 11 | verbv | |||||
verb • carve, cut, or etch into a material or surface • impress or affect deeply • carve or cut into a block used for printing or print from such a block • carve or cut a design or letters into | ||||||||
avenges | 7 | 11 | verbv | |||||
verb • take revenge for a perceived wrong | ||||||||
encaged | 7 | 11 | verbv | |||||
verb • To lock inside a cage; to imprison. | ||||||||
fenagle | 7 | 11 | verbv | |||||
Valid word for Scrabble US
| ||||||||
genevas | 7 | 11 | nounn | |||||
noun • gin made in the Netherlands • a city in southwestern Switzerland at the western end of Lake Geneva; it is the headquarters of various international organizations | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
ageneWords (77)
generalengagedelegantgrenadeteenagelineageenragedangeredenlargeavengedsenegaleugeniaavengerendgameengravegleanergrandeereagentgehennagermanenewgatemelangeavengesgatemenencagedepigeanwhangeeenragesgleanedeuglenanegatesuneagergleemantentageengages
...View all with 7 letters...
Phrases (4)
sage henbone ageend gameen gardeWords (191)
sergeantexchangenegativeteenagergardenergenerateunderagederangedagreeingeleganceengravedendangerenlargedrenegadecarnegiegermainegangrenegendarmegreenwayteenagedentanglescavengedungareeallergengelatineengraverganymedeauvergneenvisagebretagneelongatehegelianrenegateagrementcozenage
...View all with 8 letters...
Phrases (13)
zane greygenus zeamine cagenerve gasnear galein leaguegable endgreen ashgreen baygreen pea
...View all with 8 letters...
Words (379)
gentlemanchallengeagreementguaranteegenerallynegotiatepassengerencouragelegendarygeneratorrepeatingvengeancegreatnessreleasingrevealingexchangedgeneratedgreenlandespionagerearrangeentourageentangledscavengermagdalenetangerineweakeningangeliqueintegrategrievancedisengageestrangeddeafeninggrapevinedemeaningelongated
...View all with 9 letters...
Phrases (65)
range poleon averagegarden egggenus acerhome rangesea tangleangel cakeview angleguinea hengenus rhea
...View all with 9 letters...
Words (561)
generationmanagementengagementvegetarianguaranteedrehearsingchallengedencouragedpercentagecopenhagenendangeredallegiancedegeneratedesignateddelegationchallengervegetationnegotiableintegratedgeneratinggravestonerearrangedcentigrademanageablenegativelywavelengthregeneratefragmenteddecreasingringleadergreenpeacegovernancecongregatechangeablegeneralize
...View all with 10 letters...
Phrases (142)
skagen oddesponge cakegenus vespadragon treealan seegerpress agentwage earnergenus abieswagon wheelgenus dalea
...View all with 10 letters...
Words (694)
threateninginvestigatecelebratingarrangementmeaninglessacknowledgeeverlastinginterrogategeneticallypenetratingsegregationgingerbreadsafekeepingrenegotiatestrangenesspomegranateevangelicaloverbearingpaperhangeroverheatinggendarmerievinaigretteimpregnablegreasepaintextenuatinggentlemanlyunregulatedinterchangeoverhearingdegenerateddisagreeingcharlemagnegeomagneticinteragencydesecrating
...View all with 11 letters...
Phrases (254)
genus crambe's gravenhageskagens oddegenus bletiameat grinderin agreementtalent agentroentgen rayhoney badgergenus nepeta
...View all with 11 letters...
Words (721)
kindergartenentertaininginvestigatedexaggeratingcheerleadingmichelangelointerrogatedacknowledgedsleepwalkingdisagreementacceleratingexaggerationgovernmentalrecognizableregenerationmagnificenceconglomerateredecoratingdisintegrateracketeeringdegenerativedegenerationendangermentgratefulnessunchallengeddoppelgangerguaranteeingexasperatingextravagancespeechmakingunmanageablereassignmentstenographerdeliberatingrecognizance
...View all with 12 letters...
Phrases (437)
graham greenealec guinnessgenus anethumgrain cleanerarnold geselljan tinbergengeorge m. cohanhead coveringdrag one's feetcovered wagon
...View all with 12 letters...
Words (624)
unforgettableencouragementinvestigativeeavesdroppingknowledgeableheartbreakingdeterioratingdisintegratedmagnetosphererefrigerationundergraduateundercarriageargumentativeexterminatingeverlastinglynecessitatingexsanguinatedtelemarketingreintegrationoceanographerindefatigabledehydrogenaseenergeticallygeneralissimoreverberatinghousecleaningnonnegotiableungentlemanlyinterrogativedeoxygenationdecerebratinggentlemanliketransgressivestreetwalkingdisengagement
...View all with 13 letters...
Phrases (508)
genus blaberusmight-have-beenchelone glabragenus vanellusczech languagebelgian endivebreathing timeline engravinggenus saturejamachine gunner
...View all with 13 letters...
Words (502)
unrecognizableaggressivenesselectroplatingmountaineeringintelligentsiaacknowledgmentdepigmentationgeneralizationunrefrigeratedprearrangementunderachievinggovernmentallynonthreateningunrecognisableunacknowledgeddiscouragementgeneralisationoutrageousnessoverestimatingaggrandizementtelangiectasiaentertaininglytergiversationmeaningfulnessfarsightednesskindergartenerantigovernmentgregariousnessanesthesiologyreinvestigatedchangelessnessgelatinousnesssegregationistoleaginousnessintangibleness
...View all with 14 letters...
Phrases (626)
basque languagenegeri sembilangenus pelecanusgarageman's liengelatin dessertkissing diseasegenus blattellagenus sarcoptesbreathing placenoachian deluge
...View all with 14 letters...
Words (369)
electromagneticcinematographeracknowledgementanaesthesiologyinterchangeableintercollegiatespermatogenesisparthenogenesisdifferentiatingmeaninglessnessgastroenteritisgentlemanlinesscounterargumentencephalographyreinvestigatingrematerializinglightheadednessdematerializingnearsightednessinterrogatoriesheartbreakinglynongovernmentalunchallengeableinterrogativelydisgracefulnessimaginativenesspreregistrationmicromanagementultracentrifugeoverextravaganteverlastingnessagreeablenesseschangefulnessesprekindergartenepithelializing
...View all with 15 letters...
Phrases (598)
measuring deviceavestan languagefalco peregrinushigh renaissancegenus potentillasuperior generalbelgian shepherdbengali languagestrange particlegentleman-at-arms
...View all with 15 letters...
Words (152)
anesthesiologistelectromagnetismcountersignaturecounterespionagephylogeneticallyelectromagneticssphygmomanometerlightheartednessdisentanglementsantitechnologiesthermoregulatingthermoregulationhyperventilatinglargeheartednessrampageousnessescourageousnessesroentgenographicfarsightednessesweatherstrippingfeatherstitchingjungermanniaceaerechoreographinglyginopteridalescounterchallengefigurativenesseslongheadednessesinextinguishableflagitiousnessesimaginablenessesgastroenterologyupstandingnessesself-flagellationpharmacogeneticsvegetativenessespleasant-smelling
...View all with 16 letters...
Phrases (586)
multiengine planegenus crassostreagenus elaeocarpusgenus angiopterishead cabbage plantto a greater extentdefinite integralcovering materialgenus periplanetagenus proboscidea
...View all with 16 letters...
Words (81)
intergovernmentalintellectualizingknowledgeablenesscountersignaturesunexchangeabilitycounterstrategiescounterstrategistunmitigatednessesthermoregulationsdisgracefulnessessphygmomanometersicelandic-speakingferrimagneticallymorphogeneticallyoutward-developingrecognizabilitiesantireligiousnessimaginativenessesreconceptualizinggastroenterostomyindefatigablenessmultigenerationaltransgenerationalrecontextualizingimmunogeneticallyelectronegativitymagnanimousnessesfragmentarinessesmagnetoresistancerefrangiblenessesgastroenteritidesgastroenteritisesdedifferentiatingnearsightednessesprefigurativeness
...View all with 17 letters...
Phrases (517)
dame margot fonteyncompetence hearinggenus globicephalalandscape gardenergenus ceratosaurusmespilus germanicanikolaas tinbergenhypoglycemic agentinterstate highwaypearly everlasting
...View all with 17 letters...
Words (48)
gastroenterologistinterchangeabilityinexpugnablenessescounterstrategistsknowledgeabilitieslargeheartednessessphygmomanometrieslightheartednessesvaingloriousnesseslacto-vegetarianismimmunohematologiesmagnetoresistancesmagnetostrictivelyphenomenologicallygastroenterologiesgedankenexperimentgeneralizabilitiesechoencephalographadvantageousnessesgranulocytopoiesesgreatheartednessesnoninterchangeablesuperconglomeratesunpleasant-smellingmethemoglobinemiasphotodisintegratedphotodisintegrateshemoglobinopathieselectroretinogramselectroretinographgovernorate-generalcounteradvertisingcounteraggressionsroentgenologicallysacrilegiousnesses
...View all with 18 letters...
Phrases (451)
professional golfergeorge michael cohanelaeagnus commutataelaeagnus latifoliainterior decoratingottmar mergenthalergenus encephalartosgeorge simon kaufmanstar-spangled bannerpooecetes gramineus
...View all with 18 letters...
Words (31)
pneumoencephalogramknowledgeablenessesparthenogeneticallyencephalomeningitiscytopathogenicitiesgastroenterologicalgastroenterologistsgedankenexperimentsprefigurativenessesgentlemanlikenessesechoencephalographyneuropharmacologieselectromagneticallymeningoencephaliticelectronegativitiesmeningoencephalitisovercommercializingelectroretinographselectroretinographyultrasegregationistcounteradvertisingsovergeneralizationsindefatigablenessesmicropaleontologiesantiferromagnetismsinterchangeablenessovolactovegetarianspaleoanthropologiesdisadvantagednessesdisadvantageousnessradioallergosorbentPhrases (335)
measuring instrumentaquilegia canadensisrejoicing over the lawcollective agreementalpine type of glaciergiles lytton stracheymeat-packing businesspierre-auguste renoirhandle with kid glovesorganization expense
...View all with 19 letters...
Words (8)
electroencephalograminterchangeabilitieselectroretinographicultrasegregationistsroentgenographicallycounterdemonstratingsyncategorematicallynephroangiosclerosisPhrases (262)
sweet-scented geraniumarcheological remainspast progressive tensebyelorussian languageambrose gwinett bierceaugustin eugene scribeneisseria gonorrhoeaebarthold georg niebuhrgeorges henri lemaitrepoor man's weatherglass
...View all with 20 letters...
Words (11)
electroencephalographstraightforwardnessesinterchangeablenessesneuroendocrinologicalelectroencephalogramsmeningoencephalitideselectroretinographiesoverintellectualizingantiferromagneticallyindistinguishablenessdisadvantageousnessesPhrases (249)
use of goods and servicesagglutinative languageadministrative hearingfrances hodgson burnettgasterosteus pungitiuselaeagnus augustifoliaspontaneous generationbillie jean moffitt kingstephen william hawkinginterlingual rendition
...View all with 21 letters...
Words (2)
electroencephalographselectroencephalographyPhrases (180)
gregorian calendar monthtransient global amnesiaschlumbergera truncatusitalian vegetable marrowfoeniculum vulgare dulcerepublic of guinea-bissauguatemalan monetary unitivan sergeevich turgenevgreco-roman architecturearthur meier schlesinger
...View all with 22 letters...
Words (3)
electroencephalographicelectroencephalographerindistinguishablenessesPhrases (113)
gilbert and ellice islandsgeorge macaulay trevelyanboeing b-52 stratofortresspharmacological medicineapium graveolens rapaceumcapital of papua new guineaeuropean recovery programbangladeshi monetary unitunlawful carnal knowledgejohann wolfgang von goethe
...View all with 23 letters...
Words (2)
electroencephalographerselectroencephalographiesPhrases (136)
carnegie mellon universitylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensetrip the light fantastic toecapture of fort ticonderogabattle of the little bighornsir terence mervyn rattiganfrancois auguste rene rodinarthur meier schlesinger jr.
...View all with 24 letters...
Phrases (75)
miguel de cervantes saavedradiamond wedding anniversaryfrancis scott key fitzgeralddistinguished service medalcentral intelligence agencyantonio allegri da correggiobeggar-my-neighbour strategyeigenvalue of a square matrixsir arthur stanley eddingtoncharles frederick menninger
...View all with 25 letters...
Phrases (63)
charlotte anna perkins gilmanfrances eliza hodgson burnettright atrioventricular valvebrassica oleracea gongylodespolicing and enforcement costhunting and gathering societyanton grigorevich rubinsteinmalignant neoplastic diseasepersonal information managerkarl rudolf gerd von rundstedt
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (45)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinoffice of management and budgetaugustus welby northmore puginco-operative republic of guyanabeta-adrenergic blocking agentnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Phrases (49)
revolutionary people's strugglebureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concordcapital of serbia and montenegrodemocratic republic of the congofederal housing administrationludwig josef johan wittgenstein
...View all with 28 letters...
Phrases (30)
male internal reproductive organdisorganized type schizophreniaautomatic data processing systemsouth-central dravidian languagegiovanni pierluigi da palestrinaedward george earle bulwer-lyttonreceived pronunciation languagehydrangea macrophylla hortensisstephanus johannes paulus krugerautoclaved lightweight concrete
...View all with 29 letters...
Phrases (14)
glutamic oxalacetic transaminasedepartment of energy intelligencerepublic of bosnia and herzegovinaaugust friedrich leopold weismannnontricyclic antidepressant drughenri rene albert guy de maupassantsisters of st. michael the archangel1st viscount montgomery of alameinbachelor of science in engineeringferdinand victor eugene delacroix
...View all with 30 letters...
Phrases (29)
bureau of intelligence and researchmarie louise elisabeth vigee-lebrunguiseppe fortunino francesco verdisidonie-gabrielle claudine colettepalestine liberation organizationpalestinian popular struggle frontelectromotive drug administrationport-access coronary bypass surgeryislamic great eastern raiders-frontgeorges eugene benjamin clemenceau
...View all with 31 letters...
Phrases (19)
african american vernacular englishpeople against gangsterism and drugsdepartment of the federal governmentweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languageisidore auguste marie francois comtecockcroft-walton voltage multiplier
...View all with 32 letters...
Phrases (20)
linear-quadratic-gaussian controllermusical instrument digital interfaceinternational maritime organizationstandard generalized markup languageobject-oriented programming languageorganization of the oppressed on earthpityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellprivilege against self incriminationgeneral agreement on tariffs and trade
...View all with 33 letters...
Phrases (23)
relational database management systemfederal national mortgage associationgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusinterstitial cell-stimulating hormonefriedrich august kekule von stradonitzkolmogorov's strong law of large numberseuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaging
...View all with 34 letters...
Phrases (11)
revolutionary organization 17 novembercanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multipliernational socialist german workers' partyimmigration and naturalization serviceanti-imperialist international brigadefederal law enforcement training centerballistic missile defense organizationsubacute sclerosing leukoencephalitis
...View all with 35 letters...
Phrases (10)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyalbert francis charles augustus emmanuelcriminal intelligence services of canadanatural language processing applicationtiberius claudius drusus nero germanicusdeclining balance method of depreciationunited states government printing officePhrases (7)
sisters of the order of saint basil the greatdemocratic and popular republic of algeriagenerally accepted accounting principlessecretary of housing and urban developmentdefense advanced research projects agencyepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwigPhrases (7)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing servicedirectorate for inter-services intelligencegates of the arctic national park and preservebaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assay