Dictionary Only:
Profanity Off:

8-Letter Words Containing: A,N,E,G,E

 (In Any Order)
There are 191 8 letter words, 13 8 letter phrases and 0 8 letter abbr's with A,N,E,G,E in.

Best Scoring 8 Letter Words With: A,N,E,G,E

Expand?WordSave?LengthUsagePointsType
exchange8
21 verb, nounv, n
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

cozenage8
20 nounn
noun

• a fraudulent business scheme

agenized8
19 verbv
Valid word for Scrabble US
gazogene8
19 nounn
Valid word for Scrabble US
razeeing8
18 verbv
Valid word for Scrabble US
agenizes8
18 verbv
Valid word for Scrabble US
greenway8
15 nounn
noun

• a belt of parks or rural land surrounding a town or city

ganymede8
15 nounn
noun

• (Greek mythology) a Trojan boy who was so beautiful that Zeus carried him away to serve as cupbearer to the gods

• the largest of Jupiter's satellites

whangees8
15 nounn
Valid word for Scrabble US
megadyne8
15 nounn
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 8 Letter Words

Words (191)
sergeantexchangenegativeteenagergardenergenerateunderagederangedagreeingeleganceengravedendangerenlargedrenegadecarnegiegermainegangrenegendarmegreenwayteenagedentanglescavengedungareeallergengelatineengraverganymedeauvergneenvisagebretagneelongatehegelianrenegateagrementcozenagegasoleneestrangereengageenlargerliegemanabnegategamenessrenegadomelangesendamageagenciesgreatenslineageselegancyengravesgrandeesgleanersgardenedderangerdanegeltreagentsgrenadesenlargesgranteesgarneredensilageganderedshagreenrazeeingtegmentalegatinefenagledfenaglesalgerinegeneralssangareeunagreedgeminateenneagonrehangedgynaeceavegetantdefangedperigeanregentalagenesesevangelsageneticagenizedagenizesagentiveantigeneengrammebargemenpeonagesventageswhangeescarageengaleniteanergiesendgamesgennakermegadynegasogenegadareneassigneepangenesnegatersgratineesagenessrechangegamesmenthenagestangenceeugeniasinteragedanegeldderangeseuglenasdangeredgesneriagazogeneagednesstentagesengagersagenesiaagenesisregainedregaineradeemingalienageavengersgeneralesea-greenbagnetteepigaeanexigeantgenerantcentagesagremensengracedengracesbaregineevangelyagenisedagenisesledgemanetrangerengravengauntreeenchargesternagegabonesegoetheanfanteegsenrangedenrangeslargenedmerginaeenraungegavelmenangevinebegnawedpea-greenbergeniaungearedlangeredsegreantsagenitemagnesesguyanesegnetalesangleseaangleseyzigadenegazementfreegansargemonetetragenamenagedamenagesrenaguedvendagesrenaguesvendangereagencyinveaglegenliseatagareengenappesengaoledangoleseaegirineenlargenneckgearenallage
Phrases (13)
zane greygenus zeamine cagenerve gasnear galein leaguegable endgreen ashgreen baygreen peagreen teaget a linestone age
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen