Words Containing: A,L,E,Y,E
(In Any Order)
There are 2,120 words,
3,474 phrases and
0 abbr's with
A,L,E,Y,E in.
Best Scoring Words With: A,L,E,Y,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| eyelash | 7 | 13 | nounn | |||||
noun • any of the short curved hairs that grow from the edges of the eyelids | ||||||||
| walleye | 7 | 13 | nounn | |||||
noun • strabismus in which one or both eyes are directed outward • pike-like freshwater perches | ||||||||
| leeways | 7 | 13 | ||||||
noun • (of a ship or plane) sideways drift • a permissible difference; allowing some freedom to move within limits | ||||||||
| belayed | 7 | 13 | verbv | |||||
noun • something to which a mountain climber's rope can be secured verb • turn a rope round an object or person in order to secure it or him • fasten a boat to a bitt, pin, or cleat | ||||||||
| weasely | 7 | 13 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| dyeable | 7 | 13 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| delayed | 7 | 12 | verb, adjectivev, adj | |||||
adjective satellite • not as far along as normal in development | ||||||||
| eyeball | 7 | 12 | nounn | |||||
noun • the ball-shaped capsule containing the vertebrate eye verb • look at | ||||||||
| leeway | 6 | 12 | nounn | |||||
noun • (of a ship or plane) sideways drift • a permissible difference; allowing some freedom to move within limits | ||||||||
| belayer | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
aleyeWords (56)
heavenlywalleyedeasterlyleatherywesleyanheatedlyparleyedsedatelyeyeglassaldehydedelegacymeagerlymeagrelyempyrealethylateaverselyparleyerelatedlyelegancyyearliesbelayersweasellycypselaedelayershymeneallackeyedfacetelyyarmelkeobeyablepedatelyclypeatelawyeredtypeableamyleneslayerage
...View all with 8 letters...
Phrases (9)
caley peaglass eyemoray eelblack eyelady peelleap yearallen keyeagle raylake eyreWords (145)
generallylegendaryallegedlyeternallyenjoyableexemplarytelepathylafayetteelegantlyearnestlygenealogyfederallyweatherlybellyacheadverselyacetyleneawesomelyjellybeanaveragelyrelevancyalleghenypeaceablyausterelyagreeablyrepayablebelatedlyseverallydecayableacetylatehymenealshemelytrarenewablypermeablyeasefullyreanalyze
...View all with 9 letters...
Phrases (32)
alex haleyivy leaguekeep relaygerm layermealy sagelayer cakepaul heyseelihu yalesea lawyertype metal
...View all with 9 letters...
Words (196)
especiallyeventuallyscreenplayelementarypeacefullyrelativelyrepeatedlyseparatelypreferablysleepyheadnegativelydelicatelycarelesslycreativelyadequatelyexternallymoderatelyeyeglassesfearlesslyrecyclableseamlesslybelievablyreassemblyeveryplacedesolatelylymphedemalawyerlikechalybeateepiphysealaffectedlytelegraphyclydesdalecerebrallyemployablemethylated
...View all with 10 letters...
Phrases (47)
mary leakeyapple jellyaniline dyeyemeni rialrole playerheavy swellmetal moneyivy leaguerabney leveleaster lily
...View all with 10 letters...
Words (264)
immediatelynecessarilyessentiallydesperatelypermanentlygeneticallyprematurelyregrettablyshamelesslycelebratoryperpetuallyattentivelygentlemanlyeventualityhorseplayerceaselesslyequivalencydeliverymanchancelleryirrelevancyelaboratelyalternatelytentativelythermopylaepsychedeliaexpectantlymethylaminerespectablywensleydaleheartlesslyoveranalyzelieutenancyelementallyparaldehydeexuberantly
...View all with 11 letters...
Phrases (86)
louis leakeymary shelleybicycle racebicycle seataeolian lyrelevy en massemackerel skypay envelopeeudora weltyfive-year-old
...View all with 11 letters...
Words (320)
deliberatelyunbelievablyencyclopediaaggressivelyformaldehydeclytemnestralegitimatelyperipherallyelectricallyunemployableinadequatelybreathlesslyphenomenallybreathalyzerpejorativelyhermeticallypolyurethanehyperkalemiaevidentiallymealymouthedbeneficiallyeffeminatelyexhaustivelysequentiallybreathalysertetracyclineindelicatelyoxyacetyleneceremoniallyimmoderatelytransverselydeterminablyfreneticallypermeabilitymethacrylate
...View all with 12 letters...
Phrases (120)
admiral deweyread-only filehockey leagueathletic typelienal arterydevil-may-carejail deliveryedmond halleyreal propertytennis player
...View all with 12 letters...
Words (322)
unnecessarilytheoreticallyexceptionallyinadvertentlyexponentiallycomplementaryirretrievablyalternativelysupplementaryeverlastinglystereotypicalbelievabilityaestheticallyencyclopaediaenergeticallyungentlemanlydependabilitypredominatelyeccentricallysentimentallyhypercalcemiaadrenalectomyineffectuallyexistentiallytreacherouslymeaninglesslyretroactivelygeometricallyacetylcholinesuperlativelyunrepentantlyoverbearinglysoutheasterlyreverentiallyconsiderately
...View all with 13 letters...
Phrases (152)
arnold toynbeefamily poaceaealan jay lernerjekyll and hydecooley's anemiaacrylate resinvolleyball netgenus cyclamenbattle of ypresshammy leather
...View all with 13 letters...
Words (280)
intellectuallywholeheartedlyaffectionatelyelectronicallysentimentalityrespectabilityinterplanetaryelectrotherapyhyperventilateconservativelyexperimentallytelepathicallygovernmentallyencephalopathyappreciativelyelectromyogramintermediatelyentertaininglydifferentiallydepartmentallytelephonicallypreferentiallyanesthesiologyextortionatelyimpermeabilityserviceabilityempatheticallypreponderantlyillegitimatelyineffectualityabsentmindedlyheavyheartedlydeliberativelydenumerabilitygenerationally
...View all with 14 letters...
Phrases (216)
family apiaceaepearl mae baileybattle of nasebymoonseed familyfamily ardeidaeskeletal systempolymeric amidecooley's anaemialacrosse playercanterbury bell
...View all with 14 letters...
Words (222)
environmentallyanaesthesiologyheterosexualitydevelopmentallyintellectualityparentheticallyplenipotentiarymaneuverabilitytherapeuticallymethylphenidateencephalographypostoperativelydemonstrativelyheartbreakinglyinconsideratelyeuphemisticallytemperamentallyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinestheticallyunadulteratedlycontemplativelyemployabilitiescomplementaritypsychedelicallytenderheartedlymethylxanthinesdishearteninglyelectroanalysisperipateticallyconsequentiallyhyperstimulatedhyperstimulates
...View all with 15 letters...
Phrases (293)
class pelecypodaalimentary pastefamily lemnaceaefamily arecaceaefamily leporidaewassily leontieferlenmeyer flaskjoyce carol oatespipeline companyleveraged buyout
...View all with 15 letters...
Words (96)
triphenylmethanehyperventilationquintessentiallyphylogeneticallyelectromyographyextemporaneouslyhymenophyllaceaeexterritorialityparaformaldehydethermometricallyextracorporeallyhypersexualitiesantiunemploymentthermoregulatoryapocryphalnesseshyperventilatingperpendicularitylyginopteridalesstereophonicallyecclesiasticallygastroenterologycyclohexylaminesstereoregularitystereoscopicallykinaestheticallyunrespectabilityhypercellularityconsequentialityphenylethylamineleptotyphlopidaephenylketonuriasgeneralizabilityneurasthenicallyacetylsalicylateorthogenetically
...View all with 16 letters...
Phrases (341)
in a beastly mannerfamily cyperaceaewilliam wycherleyin an elaborate waycommercial agencyrelative majoritybattle of the boynefamily balaenidaenevil shute norwaycommercial treaty
...View all with 16 letters...
Words (63)
electrostaticallycontemporaneouslyinconsequentiallyisoelectronicallycercidiphyllaceaeunexchangeabilityparaformaldehydeshyperventilationschlortetracyclineferrimagneticallymorphogeneticallyencephalomyelitispentylenetetrazoldisrespectabilitylymphadenopathieshyperalimentationcytomegalovirusesimmunogeneticallyelectronegativitythiodiphenylaminephenylethylamineselectroanalyticalnephelometricallyelectrochemicallyacetylsalicylatesdehydrochlorinasedehydrochlorinatetriphenylmethanesphosphoglycerateselectrometallurgyelectromyographicmethylnaphthalenedeoxyribonucleasebacillariophyceaeretroperitoneally
...View all with 17 letters...
Phrases (343)
mary leontyne pricebalaena mysticetusmary mcleod bethunehypoglycemic agentpearly everlastingclass rhodophyceaecoccygeal vertebratheological systemcylinder separatorcommercial bribery
...View all with 17 letters...
Words (40)
inconsequentialityhyperaldosteronisminterchangeabilitypolyesterificationelectrodynamometerspectroheliographypentylenetetrazolscylindrical-stemmedhyperbilirubinemiastereospecificallydiethylmalonylureahypercholesteremiamagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesgranulocytopoiesesrepresentationallyelectromyographieselectrooculographymethylcholanthrenemethylnaphthaleneselectrophotographydeoxyribonucleasesroentgenologicallychlortetracyclinestetrachlorethylenesedimentologicallychlamydomonadaceaesemiconservativelydiethylcarbamazinehyperalimentations
...View all with 18 letters...
Phrases (342)
family physeteridaedame sybil thorndikelachrymal secretionjohn orley allen tateclass schizomycetesread-only memory chipfamily trichechidaefamily asparagaceaefamily desmidiaceaesquirreltail barley
...View all with 18 letters...
Words (35)
polyesterificationsextraterritorialityhypolipoproteinemiaparthenogeneticallyphenomenalisticallyphenylthiocarbamideechoencephalographyelectrodynamometersphosphoenolpyruvateinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalityelectrophoreticallymethylcholanthreneselectroretinographymicroelectronicallyencephalomyelitidesphenylpropanolaminehydroxytetracyclinetetrachloroethylenehydrometeorologicaltetrafluoroethyleneoverproportionatelydiethylcarbamazinestetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptamineshyperexcitabilitieshyperirritabilitiespaleogeographicallyexpressionisticallyelectrocardiographyPhrases (287)
family cyclopteridaeseventeen-year locustalpine type of glaciergiles lytton stracheyfamily lepisosteidaefamily tropaeolaceaefamily polypodiaceaehydrobates pelagicuscost-benefit analysissubfamily mephitinae
...View all with 19 letters...
Words (16)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiaelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallysyncategorematicallyhypercoagulabilitiesdimethylnitrosaminesexistentialisticallyPhrases (307)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaelebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridaedevelopmental anatomy
...View all with 20 letters...
Words (9)
stereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydeantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (191)
icelandic monetary unitaleksandr solzhenitsynhelichrysum bracteatumdesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeptolemy ii philadelphusprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidae
...View all with 21 letters...
Words (9)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (164)
venezuelan monetary unithaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forceguatemalan monetary unit
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (110)
family threskiornithidaegeorge macaulay trevelyanyellowstone national parkbangladeshi monetary unitrichard brinsley sheridantricyclic antidepressantmcguffey eclectic readerseastern malayo-polynesiangeometrical irregularityamerican federalist party
...View all with 23 letters...
Words (4)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (79)
carnegie mellon universitylouis seymour bazett leakeyprivately held corporationbrassica oleracea botrytisalexandre emile jean yersinexistentialist philosophyalfred edward woodley masonfederal republic of germanyhenry wadsworth longfellowsir charles leonard woolley
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (69)
myroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldcentral intelligence agencymelanerpes erythrocephalustrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonlepidocybium flavobrunneumreticular activating system
...View all with 25 letters...
Phrases (55)
brassica oleracea gongylodesemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizans
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (43)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (35)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridefeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguecount lev nikolayevitch tolstoy
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (27)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (26)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (11)
freedom from involuntary servitudetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencymarine corps intelligence activity
...View all with 31 letters...
Phrases (14)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (13)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (8)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentkarl friedrich hieronymus von munchhausensixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
