Words Containing: A,H,T,Y
(In Any Order)
There are 3,758 words,
2,625 phrases and
0 abbr's with
A,H,T,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
bycatch | 7 | 19 | nounn | |||||
noun • unwanted marine creatures that are caught in the nets while fishing for another species | ||||||||
pathway | 7 | 18 | nounn | |||||
noun • a bundle of myelinated nerve fibers following a path through the brain • a trodden path | ||||||||
thatchy | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
empathy | 7 | 17 | nounn | |||||
noun • understanding and entering into another's feelings | ||||||||
haughty | 7 | 17 | adjectiveadj | |||||
adjective satellite • having or showing arrogant superiority to and disdain of those one views as unworthy | ||||||||
bypaths | 7 | 17 | nounn | |||||
noun • a side road little traveled (as in the countryside) | ||||||||
ecthyma | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
healthy | 7 | 16 | adjectiveadj | |||||
adjective • having or indicating good health in body or mind; free from infirmity or disease adjective satellite • financially secure and functioning well • promoting health; healthful • exercising or showing good judgment • large in amount or extent or degree | ||||||||
wealthy | 7 | 16 | adjectiveadj | |||||
adjective satellite • having an abundant supply of money or possessions of value | ||||||||
catchy | 6 | 16 | adjectiveadj | |||||
adjective satellite • having concealed difficulty • likely to attract attention | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (78)
healthytherapynaughtycharityanthonywealthycynthiaashtrayearthlyempathyghastlyhartleypathwaydeathlyatrophyhydranthastilyhaughtytachyonhydratetallyhothreadyswarthyhayloftthruwaypythiasstarchybreathyscythiathroatyeyebathlatherychanteyhypatiabathyal
...View all with 7 letters...
Phrases (3)
by heartheat rayarmy hutWords (159)
anythingbirthdaythursdayhumanityalmightydaylightsympathymccarthyhysteriachastitymythicalhaystackstracheyheartilyfatherlyhathawayscratchystealthyhydratedhyacinthfeatherylethargydraughtyhatcheryleatheryamethystlethallyhatchwayyachtingheavysetlatchkeythessalyscythianlychgateerythema
...View all with 8 letters...
Phrases (23)
shut awaycat thymethank youin the wayr. h. tawneybayt lahmby the dayby the waywatch keyhen party
...View all with 8 letters...
Words (271)
authorityhairstyleunhealthylabyrinthtreacherypathologypantyhosedaylightstelepathyarchetypeplaythingethicallyayatollahchantillyanthologythrowawayunearthlyhealthilypanchayathydrationweatherlylymphaticantipathyseaworthydehydrateyachtsmanhyphenateschmaltzysycophanthaltinglychocolatyhesitancywealthilythackerayforsythia
...View all with 9 letters...
Phrases (28)
right awayhell to payhair styleall the waystash awaybay wreathyouth gangthomas kydstay freshmatch play
...View all with 9 letters...
Words (417)
hystericalpsychopathhereditarysympathizedehydratedthankfullypsychiatryfaithfullyunbirthdaystealthilyplaywrightpythagorasarrhythmiatopographyscathinglysympathisetypographyinhumanityarchetypalsoothsayerhabituallyhomeopathyshantytownpatriarchyapothecarytryptophantomographyasphyxiatestraightlyhootenannyethnicallyhematologyarrhythmicsociopathyflycatcher
...View all with 10 letters...
Phrases (69)
honey eaterwheat berrythird partyhouse partyray of lightwater nymphhappy eventbasil thymethomas graygenus typha
...View all with 10 letters...
Words (490)
technicallyphotographypsychiatrichospitalitysympatheticheavyweighthypothermiadehydrationhypermarkettchaikovskyhyperactivemetaphysicsbathyspheresynesthesiatachycardiatracheotomyasphyxiatedsympathizerhairstylistschenectadyphysicalitypythagoreandehydratingtypographerthermopylaerhinoplastyhypogastricsycophantichypoplastichaematologymethylamineorthographytypographiclithographysympathiser
...View all with 11 letters...
Phrases (101)
high qualitylaugh softlyjohn tyndallnodal rhythmheavy hitterdylan thomassouth by easteast by southmathew bradypoint the way
...View all with 11 letters...
Words (552)
psychiatristchristianitychemotherapyhypocriticalstraightawayhypotheticalhistoricallyauthenticitymetaphysicalanthropologymythologicalpsychopathichystericallyhorizontallyasphyxiationtechnicalitypatheticallyanaphylactichydrothermalrhythmicallyhypothalamusaromatherapytriumphantlyastrophysicsemphaticallyphilanthropymethodicallybreathlesslypraiseworthyhypnotherapybreathalyzerprophylacticcarbohydratehyperaciditythoracostomy
...View all with 12 letters...
Phrases (125)
mary mccarthyathletic typephantasy lifechristmas daywatch crystalmathew b. bradyarthur symonsfrighten awaythree-year-oldmass hysteria
...View all with 12 letters...
Words (487)
theoreticallyhomosexualityautobiographypsychoanalystpsychosomaticchrysanthemumpsychotherapyphysiotherapyastonishinglyhyperactivityunsympatheticaestheticallyhybridizationsympathectomyphytoplanktonhallucinatoryantipsychotictheatricalityarchaeopteryxcryptographerhumiliatinglystaphylococcithermodynamicsyntheticallytreacherouslyanthropophagytypographicalacetylcholinepyrophosphatetheologicallysyphilizationlymphoblastichydrogenationsoutheasterlyendolymphatic
...View all with 13 letters...
Phrases (122)
hydrated oxidecardiac rhythmclyde tombaughorder of the dayhigh-and-mightydata hierarchyshammy leatherheavy particlephrygian deitysphyrna tiburo
...View all with 13 letters...
Words (432)
hypotheticallycinematographymetaphoricallywholeheartedlymathematicallyalphabeticallynanotechnologycardiomyopathyastrophysicistpathologicallythermodynamicselectrotherapyhyperventilatepsychoanalyticcharacterologymetaphysicallytelepathicallyscholasticallynarcosynthesisphotogrammetrystaphylococcusencephalopathyinheritabilityphosphorylatedhydropneumaticorthopedicallyplethysmographarchetypicallyunthinkabilityneuropathologychromatographyhydrotherapisttelephonicallystaphylococcalanesthesiology
...View all with 14 letters...
Phrases (157)
thoracic cavityanthony burgessanthony van dyckanthony vandykemyrrhis odoratax-ray photographpharaoh of egyptprimary feathertypha latifoliaoriental cherry
...View all with 14 letters...
Words (339)
psychotherapisttechnologicallysynchronizationanaesthesiologyphysiotherapistheterosexualitysympathomimeticlymphadenopathyparentheticallytherapeuticallysynchronisationmethylphenidatelogarithmicallyauthoritativelycrystallographypsychopathologysympatheticallyarchitecturallyheartbreakinglypalaeopathologyeuphemisticallyneuropsychiatrypsychiatricallyultrasonographyimperishabilitykinestheticallythyrocalcitoninapproachabilityunchangeabilitychemoautotrophymegagametophytealgorithmicallytenderheartedlymerchantabilitymethylxanthines
...View all with 15 letters...
Phrases (187)
charlotte cordaywystan hugh audenx-ray photographynational holidayrhythmic patterncantering rhythmshorthand typistmythical monsterlymphatic vesselfour-part harmony
...View all with 15 letters...
Words (173)
enthusiasticallypheochromocytomacatastrophicallytriphenylmethanehyperventilationpsychoanalyticalphylogeneticallyelectromyographypharmaceuticallysphygmomanometererythroblastosisthermostaticallythrombocytopeniaphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablyheterokontophytathermometricallyantistrophicallyspondylarthritismicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationthermoregulatoryparasympatheticshyperventilatinghypervitaminoses
...View all with 16 letters...
Phrases (202)
italian greyhoundchristian huygenscapital of hungarygenus crotaphytushypophyseal stalkacross the countrybattle of the boynedwight lyman moodynevil shute norwayautogenic therapy
...View all with 16 letters...
Words (117)
straightforwardlyanthropologicallyparathyroidectomythermodynamicallyphilanthropicallypsychotherapeutichyperreactivitiesphysiotherapeuticunexchangeabilityhyperstimulationsparapsychologistshyperventilationsmonochromaticallysphygmomanometershypnotizabilitiesthrombocytopeniaschlortetracyclinemammothermographypathophysiologieshyposensitizationarchitectonicallymorphogeneticallyencephalomyelitiscrystallographerscrystallographieslymphadenopathieshyperalimentationlymphogranulomatacytopathogenicityprotoanthropologythiodiphenylaminebathythermographsphenylethylaminesstereophotographypheochromocytomas
...View all with 17 letters...
Phrases (227)
division bryophytaczech monetary unitmary mcleod bethunehypoglycemic agentinterstate highwaysubphylum craniatatheological systemantipsychotic drugfamily trochilidaecalycanthus family
...View all with 17 letters...
Words (77)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilityhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitispostpsychoanalyticimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadistinguishabilityhypercholesteremiasaccharomycetaceaehydroflumethiazideophthalmologicallypheochromocytomatadehydrochlorinateddehydrochlorinatesorthopsychiatristsspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesmetallographicallyelectrooculography
...View all with 18 letters...
Phrases (229)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionafghan monetary unitjohn orley allen tateclass schizomycetesfamily trichechidaeantipsychotic agentgenus chamaecytisus
...View all with 18 letters...
Words (55)
hyperparathyroidismhydrochlorothiazidecinematographicallyhypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinephosphoenolpyruvatechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylcholanthrenesanthropocentricallyanthropomorphicallyelectroretinographycharacterologicallycortico-hypothalamicencephalomyelitideshistopathologicallyhistoriographicallyhydroxytetracycline
...View all with 19 letters...
Phrases (213)
hydrastis canadensisgiles lytton stracheyphytolacca americanadivision schizophytagenus cryptobranchusavogadro's hypothesiscalycanthus floridusathyrium filix-feminaathyrium pycnocarponchinese monetary unit
...View all with 19 letters...
Words (39)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilitylymphogranulomatosesimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpseudoparenchymatoushydrochlorothiazidespsychopathologicallymicrophotometricallypsychopharmacologisthypercoagulabilitiespalatopharyngoplasty
...View all with 20 letters...
Phrases (206)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysis
...View all with 20 letters...
Words (11)
otorhinolaryngologistacetylcholinesterasesotorhinolaryngologieselectromyographicallyphotolithographicallyphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (157)
aleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphusagricultural chemistry
...View all with 21 letters...
Words (9)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesPhrases (129)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factmultiple mononeuropathysodium tripolyphosphaterhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (93)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorgroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (74)
division heterokontophytasubphylum cephalochordataprivately held corporationprimary sex characteristicantiarrhythmic medicationexistentialist philosophytechnology administrationhypersensitivity reactionhenry wadsworth longfellowhaematoxylum campechianum
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (67)
igor fyodorovich stravinskymary wollstonecraft shelleysymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (49)
hunting and gathering societydorothy mary crowfoot hodgkinemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (32)
nikita sergeyevich khrushchevaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulus
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (27)
oxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl celluloseaspidophoroides monopterygius
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (14)
disorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicbreach of the covenant of warrantyfeodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornmucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trends
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningnorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (14)
hierarchical classification systemsergei aleksandrovich koussevitzkycercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn