Words Containing: A,H,I,Y
(In Any Order)
There are 3,775 words,
2,874 phrases and
1 abbr with
A,H,I,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
hypoxia | 7 | 22 | nounn | |||||
noun • oxygen deficiency causing a very strong drive to correct the deficiency | ||||||||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hazily | 6 | 21 | adverb, adjectiveadv, adj | |||||
adverb • through a haze • in an indistinct way | ||||||||
highway | 7 | 20 | nounn | |||||
noun • a major road for any form of motor transport | ||||||||
fishway | 7 | 19 | nounn | |||||
noun • A structure built on or around dams or locks to facilitate the migration of fish. | ||||||||
hayrick | 7 | 19 | nounn | |||||
noun • a stack of hay | ||||||||
shipway | 7 | 18 | nounn | |||||
noun • structure consisting of a sloping way down to the water from the place where ships are built or repaired • a canal large enough for seagoing vessels | ||||||||
whipray | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
happily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a joyous manner • in an unexpectedly lucky way | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (67)
holidayhighwaycharityhappilyheavilycynthiahillaryhaywirehayridehastilyyeshivashakilygrayishhypoxiapythiasphrygiahandilyscythiashipwayhyalinebabyishhypatiahardilydiarchyhyaloidfishwaycharilyclayishlehayimladyishhydriaezanyishheadilyapishlylaithly
...View all with 7 letters...
Phrases (2)
hair dyemay fishWords (142)
anythingbirthdayphysicalhumanityalmightydaylighthysteriachastitymythicalepiphanyladyshipshipyardladyfishchivalryheartilyhideawaycrayfishhimalayaasphyxialavishlyhyacinthyachtingphysaliascythianachinglyshabbilyhilarityphrygiandandyishgarishlyrakishlyharryinghayfieldtoadyishyeshivah
...View all with 8 letters...
Phrases (13)
in the wayhive awaybody hairhail maryally withwill hayschip awaynaha citywhite yamhill myna
...View all with 8 letters...
Words (281)
authorityphysicianmachineryhairstylebiographyhimalayashierarchylabyrinthhemingwayhydraulicdaylightsunhappilyhydrazineplaythingchlamydiaethicallyhimalayanhairsprayoligarchychantillyporphyriahealthilyhydrationchrysalislymphaticantipathycharybdishaltinglyhesitancywealthilychicanerypsychicalforsythiahydratingdiathermy
...View all with 9 letters...
Phrases (22)
by machineright awayhair dryerhair stylewhile awaysay hey kidelihu yaleholy grailbill haleyhair spray
...View all with 9 letters...
Words (395)
physicallyhystericalhereditarysympathizepsychiatryfaithfullyunbirthdayhydraulicschemicallystealthilyplaywrightarrhythmiascathinglysympathiseinhumanitycharminglyheroicallyhabituallypatriarchyfreakishlyasphyxiatestraightlyhyperbaricethnicallyhighwaymandisharmonyarrhythmicsmashinglysociopathyhypnagogichauntinglylaughinglyrhythmicalmetaphysicmatriarchy
...View all with 10 letters...
Phrases (41)
chalcid flyspanish flyhanging flythird partyray of lightbasil thymepotty chairwhite daisyrh antibodyhemp family
...View all with 10 letters...
Words (476)
technicallypsychiatrichospitalitysympatheticheavyweightcalligraphyhypothermiadehydrationtchaikovskyhyperactivemetaphysicsfashionablyiconographybaryshnikovchronicallyhypospadiassynesthesiatachycardiaasphyxiatedsympathizerhairstylistsphericallyphysicalitydehydratingpsychicallyrhinoplastyhilariouslypsychedeliageophysicalgraphicallyhypokalemiabiophysicalhypogastrichypokalemicsycophantic
...View all with 11 letters...
Phrases (82)
high qualitysensory hairbilly grahamheavy hitteralkyl halidevarying hareanise hyssoppoint the waylamp chimneycome in handy
...View all with 11 letters...
Words (544)
psychiatristchristianityhypocriticalstraightawayhypotheticalhistoricallyauthenticitymetaphysicalmythologicalpsychopathichystericallyhorizontallyasphyxiationtechnicalitynymphomaniacpatheticallyanaphylacticrhythmicallymechanicallyperipherallytriumphantlyastrophysicsemphaticallyphilanthropyharmoniouslymethodicallypraiseworthyhypochondriaprophylactichyperaciditypsychosocialhermeticallypsychoactivetheatricallyradiotherapy
...View all with 12 letters...
Phrases (104)
shaking palsyathletic typephantasy lifechristmas daypolicy changeacid hydrogenfrighten awaymass hysteriarichard e. byrdbirthday gift
...View all with 12 letters...
Words (485)
psychologicaltheoreticallyhomosexualityautobiographyphysiologicalpsychosomatichypochondriacphysiotherapyastonishinglyhyperactivityunsympatheticaestheticallyhypoglycaemichybridizationhallucinatoryantipsychotichydraulicallytheatricalityhypercalcemiahumiliatinglystaphylococcithermodynamicsyntheticallytypographicalacetylcholinetheologicallysyphilizationunimpeachablylymphoblastichydrodynamicsrhapsodicallyhydrogenationendolymphaticimmunotherapynightmarishly
...View all with 13 letters...
Phrases (124)
harvey cushingel iskandriyahhydrated oxidecardiac rhythmhigh-and-mightydata hierarchyheavy particlephrygian deitysphyrna tiburoedmund hillary
...View all with 13 letters...
Words (476)
hypotheticallycinematographypsychoanalysismetaphoricallymathematicallygeographicallyalphabeticallycardiomyopathyastrophysicistpathologicallythermodynamicshyperventilatepsychoanalyticmetaphysicallytelepathicallyscholasticallynarcosynthesispsychodynamicsinheritabilityhydropneumaticorthopedicallyarchetypicallyunthinkabilitybiographicallyhydrotherapisttelephonicallyanesthesiologynymphomaniacalhistoriographyunhesitatinglyethnologicallypraiseworthilyhyperbolicallybrachycephaliclyophilization
...View all with 14 letters...
Phrases (165)
thoracic cavitymyrrhis odoratabusman's holidayprimary feathertypha latifoliachinese parsleyoriental cherryfamily bothidaehenry cavendishphylum annelida
...View all with 14 letters...
Words (374)
psychologicallypsychotherapisttechnologicallysynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitychronologicallysympathomimeticparentheticallytherapeuticallysynchronisationmethylphenidatelogarithmicallyauthoritativelyhypochondriacalgynandromorphicsympatheticallyarchitecturallydemographicallyheartbreakinglyeuphemisticallyneuropsychiatrypsychiatricallydiphenhydramineimperishabilitykinestheticallyadenohypophysisthyrocalcitoninapproachabilityunchangeabilitypsychedelicallyalgorithmically
...View all with 15 letters...
Phrases (243)
dialysis machinejohn quincy adamshyoscyamus nigerspiny-headed wormfamily lophiidaenational holidayrhythmic patternarachis hypogaeajemaah islamiyahcantering rhythm
...View all with 15 letters...
Words (181)
enthusiasticallycatastrophicallytriphenylmethanehyperventilationpsychoanalyticalphylogeneticallypharmaceuticallyerythroblastosisthermostaticallypsychobiologicalthrombocytopeniaphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablypornographicallythermometricallyantistrophicallyspondylarthritisradiographicallymicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologiesparasympatheticshyperventilatinghypervitaminosesmonochromaticity
...View all with 16 letters...
Phrases (238)
italian greyhoundchristian huygenscapital of hungarywilliam wycherleychemical analysisalan lloyd hodgkindwight lyman moodynevil shute norwayautogenic therapythai monetary unit
...View all with 16 letters...
Words (123)
straightforwardlyanthropologicallyparathyroidectomythermodynamicallyphilanthropicallypsychotherapeutichyperreactivitiesphysiotherapeuticcercidiphyllaceaeunexchangeabilityhyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitiesthrombocytopeniashypochondriacallychlortetracyclinepathophysiologieshyposensitizationarchitectonicallymorphogeneticallylexicographicallyencephalomyelitiscrystallographieslymphadenopathieshyperalimentationlymphangiographiccyclophosphamidescytopathogenicitypharmacologicallyoceanographicallythiodiphenylaminephenylethylaminesbibliographically
...View all with 17 letters...
Phrases (270)
division bryophytasalvia leucophyllaczech monetary unithypoglycemic agentinterstate highwaysubphylum craniatatheological systemantipsychotic drugprimary censorshipfamily trochilidae
...View all with 17 letters...
Words (78)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadistinguishabilitymucopolysaccharidehypercholesteremiaphenomenologicallyhydroflumethiazideophthalmologicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinates
...View all with 18 letters...
Phrases (267)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyafghan monetary unitclass schizomycetesread-only memory chipfamily trichechidaeantipsychotic agent
...View all with 18 letters...
Words (59)
hyperparathyroidismhydrochlorothiazidepsychophysiologicalcinematographicallyhypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallyanthropocentricallyanthropomorphicallyelectroretinographycharacterologicallycortico-hypothalamicencephalomyelitideshistopathologically
...View all with 19 letters...
Phrases (267)
hydrastis canadensisgiles lytton stracheyphytolacca americanadivision schizophytagenus symphoricarposavogadro's hypothesiscalycanthus floridusathyrium filix-feminaathyrium pycnocarponchinese monetary unit
...View all with 19 letters...
Words (38)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiesmicrophotometricallypsychopharmacologisthypercoagulabilitiesdimethylnitrosamines
...View all with 20 letters...
Phrases (237)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysisclyde william tombaugh
...View all with 20 letters...
Words (17)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (176)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphus
...View all with 21 letters...
Words (7)
spectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (143)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesbrachycome iberidifolia
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (106)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphyta
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (84)
argyroxiphium sandwicensedivision heterokontophytaprivately held corporationprimary sex characteristicantiarrhythmic medicationexistentialist philosophytechnology administrationhypersensitivity reactionsir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (63)
igor fyodorovich stravinskysymphoricarpos orbiculatuspolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blair
...View all with 25 letters...
Phrases (52)
hunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (39)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (29)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoy
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (16)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristic
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornhenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (10)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningvladimir vladimirovich mayakovskinorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn