Words Containing: A,H,I,T,Y
(In Any Order)
There are 2,311 words,
1,907 phrases and
0 abbr's with
A,H,I,T,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
charity | 7 | 15 | nounn | |||||
noun • a foundation created to promote the public good (not for assistance to any particular individuals) • a kindly and lenient attitude toward people • an activity or gift that benefits the public at large • pinnate-leaved European perennial having bright blue or white flowers • an institution set up to provide help to the needy | ||||||||
hydatid | 7 | 15 | adverb, noun, adjectiveadv, n, adj | |||||
noun • cyst filled with liquid; forms as a result of infestation by tapeworm larvae (as in echinococcosis) | ||||||||
hastily | 7 | 13 | adverbadv | |||||
adverb • in a hurried or hasty manner | ||||||||
laithly | 7 | 13 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hyalite | 7 | 13 | noun, adjectiven, adj | |||||
noun • A form of opal. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
haytiWords (43)
anythingbirthdayhumanityalmightydaylighthysteriachastitymythicalheartilyhyacinthyachtingscythianhilaritytoadyishchattilypitahayapatchilytriarchyyahrzeitarythmiaearthilythisawaywrathilyhyaliteshydatidswidthwayarythmictrashilygraithlyathyriumdispathymyriadthyachtiesrhytinascyathium
...View all with 8 letters...
Phrases (7)
in the wayally withnaha citywhite yamcity hallday shiftice yachtWords (99)
authorityhairstylelabyrinthdaylightsplaythingethicallychantillyhealthilyhydrationlymphaticantipathyhaltinglyhesitancywealthilyforsythiahydratingdiathermyhypotoniaairworthyhaughtilylethalityhydrastisthyroidaldysthymiahaecceitynaughtilythroatilycattishlyhysteriastyphoidalarythmiasheritablyantiphonypolyanthianhydrite
...View all with 9 letters...
Phrases (7)
right awayhair styleparty whiphairy roothairy tarewhig partyhit the hayWords (173)
hystericalhereditarysympathizepsychiatryfaithfullyunbirthdaystealthilyplaywrightarrhythmiascathinglysympathiseinhumanityhabituallypatriarchyasphyxiatestraightlyethnicallyarrhythmicsociopathyhauntinglyrhythmicalmetaphysicmatriarchycharitablydysarthriahaemolyticmyastheniahesitantlyatrophyingmythomaniahypostasisgothicallyethylatinghermatypicsympathies
...View all with 10 letters...
Phrases (23)
third partyray of lightbasil thymepotty chairwhite daisyrh antibodyright of waydo away withmoray firthchip away at
...View all with 10 letters...
Words (259)
technicallypsychiatrichospitalitysympatheticheavyweighthypothermiadehydrationtchaikovskyhyperactivemetaphysicssynesthesiatachycardiaasphyxiatedsympathizerhairstylistphysicalitydehydratingrhinoplastyhypogastricsycophantichypoplasticmethylaminetypographiclithographysympathiserphysiatristsympathisedmccarthyismmythomaniacsoothsayingnyctophobiamisanthropyhyphenationparathyroidparatyphoid
...View all with 11 letters...
Phrases (43)
high qualityheavy hitterpoint the wayfanny wrightwhiskey neatsylvia plathracing yachtfire hydrantwhittle awaygladys smith
...View all with 11 letters...
Words (356)
psychiatristchristianityhypocriticalstraightawayhypotheticalhistoricallyauthenticitymetaphysicalmythologicalpsychopathichystericallyhorizontallyasphyxiationtechnicalitypatheticallyanaphylacticrhythmicallytriumphantlyastrophysicsemphaticallyphilanthropymethodicallypraiseworthyprophylactichyperacidityhermeticallypsychoactivetheatricallyradiotherapyhyperthermiaenchantinglythematicallyphoneticallyexhaustivelyhypnotically
...View all with 12 letters...
Phrases (61)
athletic typephantasy lifechristmas dayfrighten awaymass hysteriabirthday giftbirthday suitpatrick henrywild hyacinthtimothy leary
...View all with 12 letters...
Words (339)
theoreticallyhomosexualityautobiographypsychosomaticphysiotherapyastonishinglyhyperactivityunsympatheticaestheticallyhybridizationhallucinatoryantipsychotictheatricalityhumiliatinglystaphylococcithermodynamicsyntheticallytypographicalacetylcholinetheologicallysyphilizationlymphoblastichydrogenationendolymphaticimmunotherapynightmarishlypolychromaticcatharticallypropheticallyauthenticallyhypercriticalastrophysicalthreateninglyinexhaustiblyhypermetropia
...View all with 13 letters...
Phrases (68)
hydrated oxidecardiac rhythmhigh-and-mightydata hierarchyheavy particlephrygian deitysphyrna tiburobig-bang theorythree kings' daygood authority
...View all with 13 letters...
Words (333)
hypotheticallycinematographymetaphoricallymathematicallyalphabeticallycardiomyopathyastrophysicistpathologicallythermodynamicshyperventilatepsychoanalyticmetaphysicallytelepathicallyscholasticallynarcosynthesisinheritabilityhydropneumaticorthopedicallyarchetypicallyunthinkabilityhydrotherapisttelephonicallyanesthesiologyhistoriographyunhesitatinglyethnologicallypraiseworthilylyophilizationempatheticallycyproheptadinestretchabilityhyperkeratoticmonolithicallylightheartedlyhypermetropias
...View all with 14 letters...
Phrases (92)
thoracic cavitymyrrhis odorataprimary feathertypha latifoliaoriental cherryfamily bothidaeartillery shellfly in the face ofchordate familyamaranth family
...View all with 14 letters...
Words (267)
psychotherapisttechnologicallysynchronizationanaesthesiologyphysiotherapistheterosexualitysympathomimeticparentheticallytherapeuticallysynchronisationmethylphenidatelogarithmicallyauthoritativelysympatheticallyarchitecturallyheartbreakinglyeuphemisticallyneuropsychiatrypsychiatricallyimperishabilitykinestheticallythyrocalcitoninapproachabilityunchangeabilityalgorithmicallymerchantabilitymethylxanthinesastrophysicistsdisenchantinglypsychohistoriansycophanticallydishearteninglyphytopathogenichypersalivationpsychometrician
...View all with 15 letters...
Phrases (127)
national holidayrhythmic patterncantering rhythmshorthand typistmythical monsterlymphatic vesselbuckthorn familybathyal districtacacia pycnanthaautophytic plant
...View all with 15 letters...
Words (140)
enthusiasticallycatastrophicallytriphenylmethanehyperventilationpsychoanalyticalphylogeneticallypharmaceuticallyerythroblastosisthermostaticallythrombocytopeniaphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablythermometricallyantistrophicallyspondylarthritismicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparasympatheticshyperventilatinghypervitaminosesmonochromaticityhypocoristicallyphotolithographynonpsychiatriststhyrocalcitonins
...View all with 16 letters...
Phrases (138)
italian greyhoundchristian huygenscapital of hungarydwight lyman moodynevil shute norwayautogenic therapythai monetary unitmechanical systemschool dictionarymythical creature
...View all with 16 letters...
Words (100)
straightforwardlyanthropologicallyparathyroidectomythermodynamicallyphilanthropicallypsychotherapeutichyperreactivitiesphysiotherapeuticunexchangeabilityhyperstimulationsparapsychologistshyperventilationsmonochromaticallyhypnotizabilitiesthrombocytopeniaschlortetracyclinepathophysiologieshyposensitizationarchitectonicallymorphogeneticallyencephalomyelitiscrystallographieslymphadenopathieshyperalimentationcytopathogenicitythiodiphenylaminephenylethylaminestransthoracicallynephelometricallyelectrochemicallydehydrochlorinateptilonorhynchidaeorthopsychiatriesorthopsychiatristtriphenylmethanes
...View all with 17 letters...
Phrases (167)
division bryophytaczech monetary unithypoglycemic agentinterstate highwaysubphylum craniatatheological systemantipsychotic drugfamily trochilidaecalycanthus familypetasites hybridus
...View all with 17 letters...
Words (66)
characteristicallyhypercoagulabilitypsychopathologicalhyperaldosteronisminterchangeabilityhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitispostpsychoanalyticimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadistinguishabilityhypercholesteremiahydroflumethiazideophthalmologicallydehydrochlorinateddehydrochlorinatesorthopsychiatristsspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesmetallographicallydemythologizationshistocompatibilitydephosphorylations
...View all with 18 letters...
Phrases (172)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionafghan monetary unitclass schizomycetesfamily trichechidaeantipsychotic agentgenus chamaecytisusshort-term liability
...View all with 18 letters...
Words (51)
hyperparathyroidismhydrochlorothiazidecinematographicallyhypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallyanthropocentricallyanthropomorphicallyelectroretinographycharacterologicallycortico-hypothalamicencephalomyelitideshistopathologicallyhistoriographicallyhydroxytetracyclinehydrometeorologicalparasympathomimetic
...View all with 19 letters...
Phrases (187)
hydrastis canadensisgiles lytton stracheyphytolacca americanadivision schizophytaavogadro's hypothesiscalycanthus floridusathyrium filix-feminaathyrium pycnocarponchinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (35)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilityimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationhydrochlorothiazidespsychopathologicallymicrophotometricallypsychopharmacologisthypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (169)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysisclyde william tombaugh
...View all with 20 letters...
Words (11)
otorhinolaryngologistacetylcholinesterasesotorhinolaryngologieselectromyographicallyphotolithographicallyphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (134)
aleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphusagricultural chemistry
...View all with 21 letters...
Words (6)
spectrophotometricallyotorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyhexamethylenetetramineencephalomyocarditisesPhrases (112)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynmultiple mononeuropathysodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidae
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (75)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorgroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (64)
division heterokontophytaprivately held corporationprimary sex characteristicantiarrhythmic medicationexistentialist philosophytechnology administrationhypersensitivity reactionhaematoxylum campechianumoxidative phosphorylationelectroconvulsive therapy
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (59)
igor fyodorovich stravinskysymphoricarpos orbiculatuspolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blair
...View all with 25 letters...
Phrases (45)
hunting and gathering societydorothy mary crowfoot hodgkinemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricum
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (32)
nikita sergeyevich khrushchevaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulus
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (26)
oxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl celluloseaspidophoroides monopterygius
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (13)
disorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicfeodor mikhailovich dostoyevskyfibrocystic disease of the breast
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornhenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningnorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (13)
hierarchical classification systemsergei aleksandrovich koussevitzkycercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united statesbosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn