Words Containing: A,E,N,N,N
(In Any Order)
There are 1,760 words,
2,941 phrases and
0 abbr's with
A,E,N,N,N in.
Best Scoring Words With: A,E,N,N,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| nankeen | 7 | 11 | noun, adjectiven, adj | |||||
noun • a durable fabric formerly loomed by hand in China from natural cotton having a yellowish color | ||||||||
| pennant | 7 | 9 | noun, adjectiven, adj | |||||
noun • the award given to the champion • a flag longer than it is wide (and often tapering) • a long flag; often tapering | ||||||||
| antenna | 7 | 7 | nounn | |||||
noun • an electrical device that sends or receives radio or television signals • sensitivity similar to that of a receptor organ • one of a pair of mobile appendages on the head of e.g. insects and crustaceans; typically sensitive to touch and taste | ||||||||
| nannies | 7 | 7 | verb, noun, adjectivev, n, adj | |||||
noun • a woman who is the custodian of children • female goat | ||||||||
| nannie | 6 | 6 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (71)
announcerannouncedmannequinintendantenhancingannulmentannoyanceunplannedmaintenonnewtoniannonnativeantiveninnonlinearsuntannedapenninescannonadebenignantnonextantannealingcannoneerinfantineensnaringtenantinguncannierbandoneonunscannedenplaningunannexedunannoyedbanneringantennulecanninesspenancingannouncesunnuanced
...View all with 9 letters...
Phrases (6)
penny anteon one handpen-and-inkchen n. yangone-and-onepenny bankWords (116)
enchantingindonesianchannelingcannelloniannexationunwinnablecantonmentnanosecondcentennialshenaniganhootenannyconnivancewantonnessentrancingunmannerednonpaymenttennesseanunlearningnonalignedunpregnantrenunciantunmannerlyannunciatebenignancyanointmentuntenantedvenenatingnonrenewalbandoneonscoannexingantiveninsensnarlingreannexingengrainingnonnatives
...View all with 10 letters...
Phrases (26)
in name onlyone and onlyanne bronteanne sextonannual ferncannon firesine qua nontank enginein any eventrunner bean
...View all with 10 letters...
Words (191)
maintenancecontainmentcontinentalintentionalconstantineunannouncedabandonmentcountenanceargentinianenchantmentcontinuanceenhancementnonsensicalindentationunrepentantchannellingenunciatinginattentionundermannedincarnadinenonchalanceundemandingrefinancingunchanneledpreplanningunmanlinessuncleannessnoninvasivecentenarianenunciationunreasoninguncongenialbenignantlyunfasteningnonattender
...View all with 11 letters...
Phrases (33)
tv announcerrunning headrunning mateloose cannonancient pinewine and dinegenus annonarunning gamemanna lichengenus nolina
...View all with 11 letters...
Words (231)
announcemententertainingconventionalpennsylvaniafrankensteinnewfoundlandcondemnationinseminationcondensationdenominationendangermenttranscendentincandescentfrankincensenonessentialrenominationincinerationentanglementrenunciationnonsectariandenunciationenchantinglynonpermanentbicentennialincineratingintransigentunsanctionedcountenancedvalenciennesunornamenteddenominatingnoncancerousnonagenarianconveyancinginseminating
...View all with 12 letters...
Phrases (68)
second bananajan tinbergengenus anhingapontoon planenelson algrenbenny goodmannew englanderlynn fontannetenpenny naileleanor gwynn
...View all with 12 letters...
Words (280)
internationalunderstandingentertainmentconcentrationenvironmentalreincarnationintentionallyconcentratinginstantaneousunintentionalunmentionablenonsequentialconsternationnonnegotiablecontraventionungentlemanlynoncompliancetranscendencenonregulationnonreturnableunconstrainedintransigenceornamentationpennsylvaniannonaccidentaltricentennialunrepentantlydisenchantingunchallengingnonmechanicalintermountainnonaggressionnonattendancenonengagementantipersonnel
...View all with 13 letters...
Phrases (121)
channel islandline engravingmachine gunnerascending nodebenjamin shahnconfidence mangenus acinonyxdandie dinmontpain sensationmountain range
...View all with 13 letters...
Words (234)
reconnaissanceconstantinopleunconventionalunconscionablenanotechnologyintentionalityunpleasantnesstranscendentalmountaineeringinternationaleunmentionablesinsignificanceconventionallyexsanguinationdenominationalnonoperationalnonthreateninguncontaminateddisenchantmententertaininglyunthankfulnessnonperformancemeaningfulnessnonresidentialantigovernmentsuperannuationunassumingnesschannelizationnonconformancediscontinuanceunidimensionalexponentiationintangiblenessrhinencephalonunchangingness
...View all with 14 letters...
Phrases (167)
genus pennatulaanthony vandykerenaissance mangenus negaprioninverse tangentnational anthemchinese lanternnever-never landgenus nicotianajohn von neumann
...View all with 14 letters...
Words (240)
internationallyunintentionallyinstantaneouslyenvironmentallydecontaminationinconsequentialunpronounceableindemnificationmeaninglessnessinstrumentationnonprofessionalenfranchisementdecontaminatingnonexperimentalgentlemanlinessinternalisationinconsiderationreconcentrationnongovernmentalunderhandednessconventionalityintensificationspontaneousnessmagnanimousnessindeterminationinternalizationconventionalismconventionalizeinattentivenessnonexploitationcounterchangingnonachievementsinsignificancesreconnaissancesnonconfidential
...View all with 15 letters...
Phrases (181)
centennial stateline of reasoningflannery o'connoranemone nemorosamerce cunninghammanner of walkingfoundation stonejuan ponce de leonindependence daykannada language
...View all with 15 letters...
Words (135)
misunderstandingintercontinentalenvironmentalisttranscontinentalenvironmentalismunreasonablenessnonrevolutionaryabsentmindednessnoncommunicativeinternationalistnonproliferationnonmetropolitansdisenfranchisingunmannerlinessesdisentanglementsunattainablenessunpleasantnessesantiunemploymentinnovativenessesnonprofessionalsunnoticeablenessinordinatenessesunrestrainednessnoncontroversialnonreappointmentjungermanniaceaeinsignificanciesdenominationallyreconcentrationsununderstandableupstandingnessesinstrumentationsrecontaminationsintangiblenessesunconventionally
...View all with 16 letters...
Phrases (226)
multiengine planein a beastly mannerhelianthus annuusrendering machinerange of a functionpeloponnesian warbenjamin franklinbenjamin harrisongenus antirrhinumhungarian pointer
...View all with 16 letters...
Words (83)
intergovernmentalunconventionalitytranscendentalisminconsequentiallytranscendentalistnondenominationalnonmathematiciansmisunderstandingsnonprofessionallynonproliferationsnonreappointmentsspontaneousnessesmountainousnessesdenominationalismindispensablenessnonsensicalnessestransgenerationalmagnanimousnessesself-incriminationconsequentialnesstransparentnessesgentlemanlikenessgentlemanlinessesopinionatednessesintercolumniationmeaninglessnessescontainerisationscontainerizationsrenationalizationgovernmentalizingindeterminatenessintergenerationalbronchopneumoniasconventionalitiesneurotransmission
...View all with 17 letters...
Phrases (249)
mount godwin austenmount kanchenjungalandscape paintingnikolaas tinbergencuban monetary unitcenter of attentionultrasound scanneralessandro manzoniinvestment companyelizabethan sonnet
...View all with 17 letters...
Words (50)
internationalizinginconsequentialitydisenfranchisementinexpugnablenessesinharmoniousnessesunreasonablenessesunrestrainednessesunseasonablenessesnonrepresentativesnonrevolutionariestranscendentalismstranscendentalistssentimentalisationsentimentalizationabsentmindednessesgedankenexperimentmalcontentednessesopinionativenessesintercolumniationsintercommunicatingrenationalizationsnoninterchangeableinterinstitutionalunpleasant-smellingdenationalizationsneurotransmissionscantankerousnessesinterminablenessesdenominationalismsnonarbitrarinessesinternationalisinginternationalitiesoverconcentrationsinconsiderablenessmicroenvironmental
...View all with 18 letters...
Phrases (228)
hindu calendar monthabel janszoon tasmanwashington monumentdrafting instrumentanamnestic reactionhindustani languageafghan monetary unitnathaniel hawthornejohn pierpont morgansecond cranial nerve
...View all with 18 letters...
Words (40)
countertransferencedisenfranchisementscompanionablenessesinstantaneousnessesencephalomeningitisconsequentialnessesgedankenexperimentsgentlemanlikenessesintercommunicationsxenotransplantationmeningoencephaliticmeningoencephalitiscontemporaneousnesspenicillin-resistantconventionalisationinterorganizationalconventionalizationinconceivablenessesinconsideratenessesphenylpropanolaminephotoreconnaissancesanctimoniousnessesanticonservationistunconscionabilitiesindeterminatenessesunconventionalitiesundemonstrativenessindispensablenessescounterinflationaryinterchangeablenesshyperconcentrationsunderrepresentationnonenforceabilitiessentimentalizationsunexceptionableness
...View all with 19 letters...
Phrases (242)
measuring instrumentitalian monetary unitlatvian monetary unitshakespearean sonnetorganization expensegentlemen's agreementdecreasing monotoniczambian monetary unitnancy freeman mitfordnational debt ceiling
...View all with 19 letters...
Words (21)
internationalizationtetrahydrocannabinolcountertransferencesunrepresentativenesscounterdemonstrationphenylpropanolaminesreinstitutionalizingnoninstitutionalisednoninstitutionalizeddeinstitutionalizingconventionalizationsinconsequentialitiesinternationalisationinconsiderablenessesphotoreconnaissancesanticonservationistscounterdemonstratingunconscionablenessesnondenominationalismindiscriminatenessesunderrepresentationsPhrases (216)
honduran monetary unitscandinavian languagemalawian monetary unitlebanese monetary unitbusiness organisationbusiness organizationindirect transmissionwalther hermann nernstcontradiction in termssecond lateran council
...View all with 20 letters...
Words (14)
alkylbenzenesulfonateinterchangeablenessesneuroendocrinologicalcontemporaneousnessesmeningoencephalitidesinternationalizationscounterdemonstrationsunconstitutionalitiesnondenominationalismsundemonstrativenessesindistinguishablenesscounterinterpretationunexceptionablenessestetrahydrocannabinolsPhrases (192)
elimination tournamentsierra nevada mountainsfrances hodgson burnettexperimental conditionicelandic monetary unitaleksandr solzhenitsynmalaysian monetary unitbulgarian monetary unitspontaneous generationtelephone conversation
...View all with 21 letters...
Words (6)
unrepresentativenessesnonrepresentationalismreinstitutionalizationdeinstitutionalizationdihydroxyphenylalaninecounterinterpretationsPhrases (144)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinatransient global amnesianavigational instrumentaleksandr i. solzhenitsynjohn ronald reuel tolkienpeloponnesian peninsulaguatemalan monetary unitthousand island dressing
...View all with 22 letters...
Words (4)
nonrepresentationalismsreinstitutionalizationsdeinstitutionalizationsindistinguishablenessesPhrases (114)
to all intents and purposesyellowstone national parkaugust wilhelm von hofmannkazakhstani monetary unitparis-sorbonne universitykyrgyzstani monetary unitantoine laurent de jussieubangladeshi monetary unitsouth korean monetary unitunlawful carnal knowledge
...View all with 23 letters...
Phrases (125)
carnegie mellon universityprofessional organisationprofessional organizationsir terence mervyn rattiganfrancois auguste rene rodincapital of northern irelandhunting and gathering tribealexandre emile jean yersinmagnetic resonance imagingradio detection and ranging
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (89)
count ferdinand von zeppelindiamond wedding anniversarychemical weapons conventioncruel and unusual punishmentnational science foundationcentral intelligence agencyamerican baptist conventioninternational organisationinternational organizationneonatal intensive care unit
...View all with 25 letters...
Phrases (69)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettx-linked dominant inheritancenational institutes of healthpolicing and enforcement costhunting and gathering societylassen volcanic national parkanton grigorevich rubinstein
...View all with 26 letters...
Phrases (57)
business environment analysisoffice of management and budgetnational labor relations boardbeta-adrenergic blocking agentelectronic musical instrumentdeoxyadenosine monophosphateinternational court of justicethyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtenstein
...View all with 27 letters...
Phrases (57)
bureau of engraving and printingephippiorhynchus senegalensiscommission on the status of womenbattles of lexington and concordthird council of constantinoplecapital of serbia and montenegrocriminal investigation commandfederal housing administrationludwig josef johan wittgensteincongregation of the inquisition
...View all with 28 letters...
Phrases (48)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinacrylonitrile-butadiene-styrenemale internal reproductive organnational volunteers associationcombination in restraint of tradesouth-central dravidian languagegiovanni pierluigi da palestrina
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (33)
valentina vladmirovna tereshkovaalexander isayevich solzhenitsynself-report personality inventorydepartment of energy intelligencedepository financial institutionrepublic of bosnia and herzegovinauniversal gravitational constantbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborn
...View all with 30 letters...
Phrases (43)
great smoky mountains national parkbureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologypetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defenserevolutionary proletarian nucleuschickasaw national recreation areapalestine liberation organization
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (23)
african american vernacular englishpeople against gangsterism and drugsdepartment of the federal governmentintercontinental ballistic missilerevolutionary justice organizationobject-oriented programing languagecount nikolaus ludwig von zinzendorfnonsteroidal anti-inflammatory drugnational liberation front of corsicainsulin-dependent diabetes mellitus
...View all with 32 letters...
Phrases (27)
linear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagecongress of industrial organizationsobject-oriented programming languageorganization of the oppressed on earthelizabeth cleghorn stevenson gaskell
...View all with 33 letters...
Phrases (19)
relational database management systemconfidential adviser-advisee relationfederal national mortgage associationacademy of television arts and sciencesinterstitial cell-stimulating hormoneeuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtzfour-stroke internal-combustion engine
...View all with 34 letters...
Phrases (23)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontcomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (16)
center for disease control and preventionrank-difference correlation coefficientangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfreedom from cruel and unusual punishmenttransportation security administrationinternational association of lions clubscriminal intelligence services of canada
...View all with 36 letters...
Phrases (15)
severe combined immunodeficiency diseaseunited states declaration of independenceuniversity of north carolina at chapel hillcentre for international crime preventiongenerally accepted accounting principlessecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdepartment of health education and welfarekarl friedrich hieronymus von munchhausen
...View all with 37 letters...
Phrases (8)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systeminternational civil aviation organizationeconomic commission for asia and the far eastdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (10)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing servicedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assayPhrases (10)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkeinternational relations and security networkursulines of mary immaculate virgin of gandinotrillion floating point operations per secondPhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (8)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
