Words Containing: A,D,L,R,Y
(In Any Order)
There are 1,471 words,
2,208 phrases and
0 abbr's with
A,D,L,R,Y in.
Best Scoring Words With: A,D,L,R,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
darkly | 6 | 14 | adverb, adjectiveadv, adj | |||||
adverb • without light • in a dark glowering menacing manner | ||||||||
drywall | 7 | 14 | nounn | |||||
noun • a wide flat board used to cover walls or partitions; made from plaster or wood pulp or other materials and used primarily to form the interior walls of houses | ||||||||
halyard | 7 | 14 | nounn | |||||
noun • a rope for raising or lowering a sail or flag | ||||||||
hardily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
hardly | 6 | 13 | adverbadv | |||||
adverb • only a very short time before • almost not • slowly and with difficulty | ||||||||
rapidly | 7 | 13 | adverbadv | |||||
adverb • with speed | ||||||||
broadly | 7 | 13 | adverbadv | |||||
adverb • without regard to specific details or exceptions • in a wide fashion | ||||||||
pyralid | 7 | 13 | nounn | |||||
noun • usually tropical slender-bodied long-legged moth whose larvae are crop pests | ||||||||
pedlary | 7 | 13 | nounn | |||||
noun • The trade or goods of a peddler. • Trickery | ||||||||
acridly | 7 | 13 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (93)
cowardlyadulteryrandomlymarylandabsurdlyladybirdidolatrywordplaybenadrylardentlylysanderadroitlymarkedlydreamilyunderlayrailyardinwardlycharladyparleyedribaldrysaddleryupwardlylombardydilatoryheraldryraggedlyradiallyadorablydaringlywizardlyreadablydefrayalforeladyalderflydapperly
...View all with 8 letters...
Phrases (18)
dry cleaniron ladylord's daycd playerdelta raylunar daydevil raydry plateyard lineyard sale
...View all with 8 letters...
Words (151)
graduallylegendaryparalyzedyggdrasildragonflyradicallyparalysedhydraulicadmiraltyswordplayawkwardlyradiologydastardlyfoolhardycordiallyroundelayoutwardlyfederallyfairylandpyramidaladmirablyassuredlyadverselychandleryradiantlyunderplaymedullarycomradelyadoringlyarduouslychrysalidclepsydralaudatoryguardedlythyroidal
...View all with 9 letters...
Phrases (15)
early birdearly daysdry cerealgrey alderlead storyraoul dufyleyden jargray alderfirst ladyray m. dolby
...View all with 9 letters...
Words (169)
playgroundrepeatedlysolidarityordinarilyhydraulicsschoolyarddreadfullymoderatelycardiologymyocardialdurabilitylumberyardcardplayerlaundrymanhydroplaneladyfingerformidablydaughterlymodularityauditorilydepilatorycordialityadmiringlytalleyranddownwardlydeplorablyundulatoryobduratelypardonablyholidayersunderplaysclepsydrasdragginglyadherentlyassertedly
...View all with 10 letters...
Phrases (27)
lead astraydry wallinglady killerdaily breaddaily orderharold ureyday laborerhoward pyledart playertom bradley
...View all with 10 letters...
Words (171)
desperatelyaccordinglydangerouslydrasticallypterodactyldeliverymanpredictablyvaledictorycylindricalcrystalloidhaphazardlyundesirablydisarminglyparaldehydesecondarilyadorabilityadvertentlydeclaratorylegendarilyeditoriallydermatologyreadabilitybarefacedlymandatorilygrandioselyendearinglydaredevilrypyramidicalprodigalityhazardouslyunderplayedregardfullyredundantlydenumerablyveridically
...View all with 11 letters...
Phrases (67)
admiral byrddry cleaningacrylic acidmemorial daybald cypressnodal rhythmlaundry cartboulder claygravy holdereudora welty
...View all with 11 letters...
Words (218)
deliberatelydramaticallydisciplinaryconsiderablyformaldehydeperiodicallyhydrothermalcrystallizeddesirabilitydisastrouslydiscordantlydemonstrablysporadicallydespairinglydishonorablyfraudulentlycardiomegalylaundrywomanunpardonablyimmoderatelyhydroplaningconcordantlydeterminablyoveranalyzedlandlubberlyhydrologicalinordinatelycrystallisedirredeemablyadmirabilityabstractedlyhydrocephalyvaletudinaryholidaymakerdaredeviltry
...View all with 12 letters...
Phrases (104)
mary magdalenadmiral deweyread-only fileadmiralty lawmaterial bodydevil-may-caredramatic playsalivary ductjail deliveryalkyl radical
...View all with 12 letters...
Words (190)
traditionallyinadvertentlypredominantlyparadoxicallydissimilarityhydraulicallypredominatelyhydrocephalusdisparaginglyadrenalectomydiametricallyindescribablydisgracefullyrhapsodicallyquadrenniallyconsideratelydeferentiallyhydrocephalicembarrassedlyunpredictablyunderhandedlydactylographycreditabilityradioactivelydishonourablyhalfheartedlydiscreditablydictatoriallyhyaluronidasedetrimentallyspreadabilityholidaymakerssoftheartedlyhyperinflatedprejudicially
...View all with 13 letters...
Phrases (113)
el iskandriyahfamily laridaearnold toynbeeadmiralty mileuranyl radicalcanary islandssalivary glanddna polymerasesolidarity taxedmund hillary
...View all with 13 letters...
Words (168)
wholeheartedlyunderstandablydemocraticallypredictabilityphosphorylatedinconsiderablyintermediatelydifferentiallyprovidentiallyorthopedicallydepartmentallydirectionalitydisapprovinglypreponderantlyheavyheartedlydeliberativelydenumerabilitylightheartedlydiscouraginglygreatheartedlyupgradeabilityunrestrainedlyambidextrouslyparadisiacallypreponderatelyelectrodynamicconcentratedlyhydrocolloidalhydrodynamicaldemoralizinglystoutheartedlyantidromicallyrecrystallizedadrenergicallyindemonstrably
...View all with 14 letters...
Phrases (144)
lachrymal glandfamily ardeidaepituitary glandadmiralty brassadmiralty metalmodal auxiliarypolymeric amidefamily turdidaefamily bramidaefamily rallidae
...View all with 14 letters...
Words (134)
extraordinarilyaerodynamicallycardiopulmonarydramaturgicallypolyunsaturateddemonstrativelyhypochondriacaldemographicallyinconsideratelyperpendicularlydemonstrabilitybidirectionallyunadulteratedlyhydromechanicalimponderabilitytenderheartedlypolysaccharidesdishearteninglyautotetraploidyhyperstimulatedhydroxylapatitehydrobiologicalsuperabundantlyradiometricallysemicylindricaldorsoventralitydisinflationarytetramethylleadpolyacrylamidesreduplicativelyuntraditionallycontradictorilyindeterminatelyunderstandinglyhyperlipidemias
...View all with 15 letters...
Phrases (208)
auditory ossiclecharlotte cordaymail-order buyingby trial and errorfamily leporidaefamily artamidaeadmiralty islandfamily triglidaeradial asymmetryleveraged buyout
...View all with 15 letters...
Words (38)
indiscriminatelyunpredictabilitydiscriminatorilyparadigmaticallyjurisdictionallyparaformaldehydespondylarthritisradiographicallyadministrativelyperpendicularitylyginopteridalesstrongyloidiasesstrongyloidiasisdecarboxylationsimmunomodulatorybiodegradabilityindescribabilityelectrohydraulichyperlipoidaemiaundemocraticallydephosphorylateddephosphorylatesdepolymerizationpalaeodendrologyhydrodynamicallytranscendentallydiacetylmorphinehydroxylapatiteslabyrinthodontiamelodramaticallythelypteridaceaediagrammaticallyununderstandablytetramethylleadslepidobotryaceae
...View all with 16 letters...
Phrases (192)
italian greyhoundfamily cyprinidaecardiac glycosidepodocarpus familycock-and-bull storyexemplary damagesschool dictionarylaundry stiffenerfamily elateridaeisland of guernsey
...View all with 16 letters...
Words (35)
straightforwardlythermodynamicallymultidisciplinaryinterdisciplinaryself-contradictoryradiobiologicallycercidiphyllaceaeparaformaldehydesradioisotopicallyhypochondriacallyunderstandabilityidiosyncraticallydisrespectabilitytransdisciplinaryhydrofluorocarbondehydrochlorinasedehydrochlorinatetridimensionalityptilonorhynchidaejurisprudentiallyturbidimetricallydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationsphotoperiodicallydeterministicallyhydroelectricallyhydrometallurgieshydrometallurgistdiaphragmaticallyundemonstrativelydifferentiabilityeleutherodactylusdimethylhydrazinePhrases (219)
mary mcleod bethuneclass rhodophyceaecylinder separatorcylindrical liningfamily trochilidaecaesarian deliverycapital of marylandfamily droseraceaemiles dewey davis jr.family engraulidae
...View all with 17 letters...
Words (20)
disproportionatelyhyperaldosteronismelectrodynamometercylindrical-stemmedlipopolysaccharidediethylmalonylureamucopolysaccharidehydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesdeoxyribonucleasespropagandisticallydephosphorylationshydrometallurgicalhydrometallurgistsindiscriminatinglydiethylcarbamazinedimethylhydrazinesdimethyltryptaminePhrases (184)
bombycilla cedrorunfamily physeteridaedame sybil thorndikefreudian psychologyread-only memory chipfamily trichechidaemodal auxiliary verbmegacycle per secondmarquis de lafayettearthur garfield hays
...View all with 18 letters...
Words (19)
hydrochlorothiazidemucopolysaccharideslipopolysaccharidespharmacodynamicallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationelectrodynamometersinterdepartmentallycontradistinctivelythird-dimensionalitythree-dimensionalityhydroxytetracyclinehydrometeorologicaldiethylcarbamazinestetramethyldiarsinedimethylnitrosaminedimethyltryptamineselectrocardiographyPhrases (181)
family cyclopteridaefamily dasyproctidaecalycanthus floridushydrobates pelagicussubfamily perdicidaeviral delivery vectorsolidarity surchargedisability insurancefamily calliphoridaegerard manley hopkins
...View all with 19 letters...
Words (7)
tetrahydrocannabinolradioimmunoassayablephenylthiocarbamidesdehydrochlorinationsencephalomyocarditishydrochlorothiazidesdimethylnitrosaminesPhrases (178)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaefamily dermochelyidaedianthus caryophyllussuricata tetradactylaambystomid salamanderfriendly relationshiporder actinomycetales
...View all with 20 letters...
Words (5)
mucopolysaccharidosisphosphoglyceraldehydedendrochronologicallypolyvinyl-formaldehydetetrahydrocannabinolsPhrases (116)
icelandic monetary unitaleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidaefederal security bureausyngnathus hildebrandi
...View all with 21 letters...
Words (3)
phosphoglyceraldehydesencephalomyocarditisesdihydroxyphenylalaninePhrases (98)
redevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesmale reproductive system
...View all with 22 letters...
Words (1)
hydrochlorofluorocarbonPhrases (80)
family threskiornithidaeposterior pituitary glandthryothorus ludovicianuscanyonlands national parkbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillatatricyclic antidepressantmcguffey eclectic readers
...View all with 23 letters...
Words (1)
electrocardiographicallyPhrases (50)
subphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley masontechnology administrationfederal republic of germanyhenry wadsworth longfellowsir charles leonard woolley
...View all with 24 letters...
Phrases (41)
embryonal rhabdomyosarcomafrancis scott key fitzgeraldpolystichum acrostichoidescaulophyllum thalictroidessir arthur stanley eddingtonlepidocybium flavobrunneumreticuloendothelial systemarab revolutionary brigadesmachine readable dictionarydiesel-hydraulic locomotive
...View all with 25 letters...
Phrases (30)
brassica oleracea gongylodessubmandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (34)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugbaron lloyd webber of sydmontontopical prostaglandin eyedrop
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (18)
aleksandr feodorovich kerenskyoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulosenonsteroidal anti-inflammatory
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonfrancisco jose de goya y lucientestheory of punctuated equilibriumfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (10)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidmucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusdame agatha mary clarissa christiePhrases (12)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugtheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united states
...View all with 32 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay